SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015820 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015820
Domain Number 1 Region: 170-363
Classification Level Classification E-value
Superfamily E set domains 4.67e-80
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000841
Further Details:      
 
Domain Number 2 Region: 63-186
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-23
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015820   Gene: ENSTNIG00000012845   Transcript: ENSTNIT00000016030
Sequence length 435
Comment pep:novel chromosome:TETRAODON8:2:6850230:6851537:-1 gene:ENSTNIG00000012845 transcript:ENSTNIT00000016030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMSVGRINRYSIVSSEEEGLRLTTMHGMNGFGNGKVHTRRKCRNRFVKKNGQCNVQFANM
EDKSQRYMADIFTTCVDIRWRWMLVVFTLVFVVSWLAFGLAFWVIALLHGDLDNPAGDDN
FTPCVLQVNGFVAAFLFSIETQSTIGYGYRCVTEECPVAVFMVVFQSIVGCIIDCFMIGA
IMAKMARPKKRAQTLLFSHNAVIAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITD
EGEYIPLDQIDINVGFDKGLDRIFLVSPITILHEIDEESPLFGISKQDLETSDFEIVVIL
EGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNMYKVDYSHFHKTYEVPSTPRCSA
KDMVENKFLVPSSNSFCYENELAFLNRDEEEEEDVGGVGRALANLSPDRNSRHEFDRLQA
TRVLDQRSYRRESEI
Download sequence
Identical sequences H3D5N1
99883.ENSTNIP00000015820 ENSTNIP00000015820 ENSTNIP00000015820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]