SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015897 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015897
Domain Number 1 Region: 9-49
Classification Level Classification E-value
Superfamily UBA-like 0.000000219
Family TAP-C domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015897   Gene: ENSTNIG00000012917   Transcript: ENSTNIT00000016107
Sequence length 169
Comment pep:novel chromosome:TETRAODON8:2:5844246:5852537:-1 gene:ENSTNIG00000012917 transcript:ENSTNIT00000016107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CASKMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYGHHHQM
MCAPANTPATPPNFPDALTMFSRLKASESFTSGSVQQPHGRLHGHLSPTPAPAVGRLRAL
RPTCPTCRRPRRLWTQGQPPTQPCPTWPMGVNSHAGAEQKASVAMEAER
Download sequence
Identical sequences H3D5V7
ENSTNIP00000015897 ENSTNIP00000015897 99883.ENSTNIP00000015897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]