SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015904 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015904
Domain Number 1 Region: 9-184
Classification Level Classification E-value
Superfamily RUN domain-like 1.06e-40
Family RUN domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015904   Gene: ENSTNIG00000012924   Transcript: ENSTNIT00000016114
Sequence length 286
Comment pep:known_by_projection chromosome:TETRAODON8:2:5657338:5660689:1 gene:ENSTNIG00000012924 transcript:ENSTNIT00000016114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AESQQSDAKRQHLLERLLDAVKQCQIRFGGRKEIATDSDSRVICLCAQFEAVLQHGLRKT
RGLALTAAALKQAAGFSSKNEGDLTFWFYVKEHLNRHELQRFYSLRHISSELGRGRAWLR
CALNEHSLERSLHSLLADHSRLGTYYEDWSFILDEEKASMLPTMAAGLNSILFAINIDNT
DLNGGLSRGAGTSVSHLLKESTQGIGSLWKESAQGVSSLLREISTATSVVPGFTPRADGA
SDPLPVLPRSTSADSGLRKERRRKKKVTNIISFDDDLDGGDEDEGD
Download sequence
Identical sequences H3D5W4
99883.ENSTNIP00000015904 ENSTNIP00000015904 ENSTNIP00000015904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]