SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015940 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015940
Domain Number 1 Region: 29-159
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-32
Family C-type lectin domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015940   Gene: ENSTNIG00000012961   Transcript: ENSTNIT00000016151
Sequence length 160
Comment pep:novel chromosome:TETRAODON8:1_random:1006400:1009972:-1 gene:ENSTNIG00000012961 transcript:ENSTNIT00000016151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRLLTALLLLGLLQNAAPSSLHGISKRSPGCPDGWNELRFKTCMRLFTEKKTFDEAEQ
HCVSLGGHLVSIHGGGEFYEVLTLAVKSYRYAIPVWTGARYNEQEQRWKWTDGTSFSFVH
QHGSLTDKKGGCVEMNRQVWGGWKIMNCDVKQFYVCAKRS
Download sequence
Identical sequences Q4S497
99883.ENSTNIP00000015940 ENSTNIP00000015940 ENSTNIP00000015940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]