SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016484 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016484
Domain Number 1 Region: 168-239
Classification Level Classification E-value
Superfamily Homeodomain-like 2.4e-20
Family Homeodomain 0.0015
Further Details:      
 
Domain Number 2 Region: 31-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000759
Family LIM domain 0.012
Further Details:      
 
Domain Number 3 Region: 3-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000371
Family LIM domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016484
Domain Number - Region: 92-126
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0368
Family LIM domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016484   Gene: ENSTNIG00000013489   Transcript: ENSTNIT00000016697
Sequence length 396
Comment pep:known_by_projection chromosome:TETRAODON8:4:4503683:4511732:1 gene:ENSTNIG00000013489 transcript:ENSTNIT00000016697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVHCAGCERPILDRFLLNVLDRAWHAKCVQCCECSCNLTEKCFSRDGKLYCKMDFFRRF
GTKCAGCLQGISPNDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKEDFL
SSGAIKEANLNSVSSCTDRSLSPDLQDPTQDDIKETDNSTSSDKETNNIENEEQNSGTKR
RGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRGPRRMRTLGGRLEDPDILGPGAYGYYGEYQGDYYGPGSNYDFFPHGP
PSSQAQSPAESPYILGSGPGGMEGSGHRPSEDQRFTDMISHAETPSPDPGLPGSLQPVPG
EAYGGGPSPPFSMASNSSYSAPMSHQGQEMGESAAW
Download sequence
Identical sequences H3D7J3
99883.ENSTNIP00000016484 ENSTNIP00000016484 ENSTNIP00000016484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]