SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016841 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016841
Domain Number 1 Region: 390-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 2 Region: 198-307
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000105
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 3 Region: 29-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000116
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 4 Region: 144-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016841
Domain Number - Region: 362-389
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000903
Family LDL receptor-like module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016841   Gene: ENSTNIG00000013837   Transcript: ENSTNIT00000017055
Sequence length 693
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:951237:954285:-1 gene:ENSTNIG00000013837 transcript:ENSTNIT00000017055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSALFIFTAALFPGLLTSPKRIFPSVICGRSPQVLESRDGEIRSSSYYSWSYRYGSCYD
CWIIKGSEGEPVVLSFSQFSARCRKEWVSIRSSDGGEPVLLCGSKLPKPMEFPGGNITVT
HHFLPHLFPVSSFLLSYARDTGECPLTSFECLGGRCLPLSWRCNGRVECLDEGTALGTDE
QGCGAEEEPTESTANTSTWPCGGLLQTFYGTFSPPALRGPALFCVWTLDPQDSRPLRLDL
QQLVLGPGDKLTVYSRGNGKGDVLKTITSSSNYKSVQVESTTGLLSLAYETLPGSEGNGF
NATFHVGAYCPPWGYTQEQMCDGKYDCPETGRDEKGCKGCGVDQFVCGPTGQRMSTGAHY
GGRPVCYPAKERCNYQLYCSDGSDERDCTVCQPGTFHCDSDRCVFESWRCDGQVDCKDGT
DELNCTVILPRKVITAATVGSLVCGLLLVIAMGCTCKLYSLRTREYSSLFAPISRQEAEL
IQQQAPPSYGQLIAQGIIPPVEDFPTENPNETSSLSLRGILQLLRQDPTNSPHRRRRPRF
VRRAVRRMRRWGLMPRASSRPSQPPNGGQQPSEAGPSAQQGSRAAPTASSSAVQQQGGGR
SSPLPPPQPPPVTSTPPPPYAPPAPPAATPPVVVPSSGSTLASIFHTLGLNIFLFRASPS
SSSTNSMALSDDDVLLIPLTEDAASEDDVPMLT
Download sequence
Identical sequences H3D8K0
99883.ENSTNIP00000016841 ENSTNIP00000016841 ENSTNIP00000016841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]