SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017284 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017284
Domain Number 1 Region: 277-488
Classification Level Classification E-value
Superfamily SIS domain 3.34e-20
Family mono-SIS domain 0.001
Further Details:      
 
Domain Number 2 Region: 54-154
Classification Level Classification E-value
Superfamily SIS domain 0.000000147
Family mono-SIS domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017284   Gene: ENSTNIG00000014270   Transcript: ENSTNIT00000017502
Sequence length 566
Comment pep:known_by_projection chromosome:TETRAODON8:3:4336678:4340938:1 gene:ENSTNIG00000014270 transcript:ENSTNIT00000017502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YEPSLPVSEKSNPLTGDIDRASASTIVRMLQACDGQMFEEDAGVGYQRLFSKEVVETMVE
VAKKVELILKDPQDSLVVLSGCGTSGRIAFLIASCFNKRLKDISQSLVFSYIIAGGDRAL
FSSHEAPEDDGRLGMLMLKEACEGKKRVLFFGISCGLSAPFVAGQLDFCLQHPEVYIPVL
IGFNPAHQARNEPIAGCTFTFHSVMQRMLELEQSQKAFIVSPAVGPEAISGSSRMKGGSA
TMILLEVILSAAQAAAFTRAPVTEKVILQSMLAYKSTVDVTYSHTERISTLVEAAGKSLR
CSGRVCYLGWGSLAVLGLIDASECNPTFGADYEDVRGFIAGGYAELNNNEGPLTSLGPDF
SISHEDFLRLILPLLTDRDTVLLLFTRSEVLGEDVQMARRVRQKSVFVQNLCSSTLQISW
PSPLTEGSVQMLSLCQQWELSTKLLLNAVSTGAHVLKGKVYQNHMVDVQVTNTKLFRRAA
RLLQKLSGHPKLQCEEALLKAIYQSEQLTSDITSSDVGTHTLVAKHRTRVVPLALILLLT
NCSLKEAESRLQQQPIVREVVVLCLS
Download sequence
Identical sequences H3D9U3
ENSTNIP00000017284 ENSTNIP00000017284 99883.ENSTNIP00000017284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]