SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017333 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017333
Domain Number 1 Region: 33-247
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-65
Family SPRY domain 0.000000016
Further Details:      
 
Domain Number 2 Region: 236-273
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000418
Family SOCS box-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017333   Gene: ENSTNIG00000014317   Transcript: ENSTNIT00000017551
Sequence length 274
Comment pep:known_by_projection chromosome:TETRAODON8:16:7423622:7426675:1 gene:ENSTNIG00000014317 transcript:ENSTNIT00000017551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKISGGIKSVDVRGEPSYQPLRRELQGPDFCRPPRLDMLLDMPLAGPESQLRHAWNPD
DRSLNVFVKEDDKLTFHRHPVAQSTDCIRGRVGYTRGLHVWRIHWPARQRGTHAVVGVAT
AEASLHSVGYTALVGSDSESWGWDLGRNRLYHDAKNRPAPTYPSFLEADESFVIPDALTV
MLDMDEGTLSFMVDGQYLGVAFRGLKGKKLYPIVSAVWGHCEVSIRYVNGLDPEPLPLMD
LCRRAARLALGRERIHHIDALPLPQTLKNYLQYQ
Download sequence
Identical sequences H3D9Z2
ENSTNIP00000017333 99883.ENSTNIP00000017333 ENSTNIP00000017333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]