SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017363 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017363
Domain Number 1 Region: 166-280
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-37
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 7-118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 3 Region: 332-444
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.44e-28
Family Frizzled cysteine-rich domain 0.00026
Further Details:      
 
Domain Number 4 Region: 283-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 123-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017363   Gene: ENSTNIG00000014346   Transcript: ENSTNIT00000017581
Sequence length 446
Comment pep:known_by_projection chromosome:TETRAODON8:16:7944692:7947247:1 gene:ENSTNIG00000014346 transcript:ENSTNIT00000017581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPDRPLGCGAVLTDLEGSFSSPNHPGSYPPNLLCMWVIQVPAPFVVQIHVLNLAVEGPSP
CLFDWLEVQEQMALSSVVIRFCGNVAPPTVNTNSSKVWVTFRSDGTIAGSGFAAQYRALL
PGHKSCSRDEFLCDSGRCLLPASVCDGHPNCQDQTDESNCSHKHKDCGGQKSGPSGHLSS
PNHPGNYPHQQLCIWHLSVEEGHVITLSFRNFSLETQDVCEFDYVEVHDSLNTGAGRVLG
RFCGTTLPPDLTSSGPHMSVVFVADEGVADSGFNATYQAVSLLDRTCASNQFACSTGECL
QPQWLCDGWNDCPDAADEHGCDNSTYPPFISSCETIEVEMCRGLSYNLTSFPNIWLSIAD
QREAAALLQQYRVLMDLACFQPLRRLVCGMFLPQCSPQGGVLQPCRSVCSSAEQQCSQAL
DLFSFSWPFNCHLLPDLHDPTECSLP
Download sequence
Identical sequences H3DA22
ENSTNIP00000017363 ENSTNIP00000017363 99883.ENSTNIP00000017363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]