SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017417 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017417
Domain Number 1 Region: 181-246
Classification Level Classification E-value
Superfamily Homeodomain-like 1.03e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 30-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000873
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 2-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000389
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000017417
Domain Number - Region: 91-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0174
Family LIM domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017417   Gene: ENSTNIG00000014399   Transcript: ENSTNIT00000017635
Sequence length 411
Comment pep:known_by_projection chromosome:TETRAODON8:16:8777475:8782868:-1 gene:ENSTNIG00000014399 transcript:ENSTNIT00000017635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGRLYCKNDFFRRFG
TKCGGCFQGISPNDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLS
NSNVKDTNLLSRHAVTTCSDPSLSPDSQDQLQDDVVLKDTEIAALSDKETVNNENDDQNL
GGKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKER
RMKQLSALGARRHAFFRSPRRMRPLMDRLEPGELIPNGPFSYYGDYQSEYYGPGGNYDFF
PQGPPSSQAQTPVDLPFVPSSGPTGTPLGTMDHPLPGHHPSSEAQRFSDIMSHHPGDSPS
PEPGIPGPLHSSISSEVFGPSPPFTSLSLNGSGYNNHLSHPPSEMNEGTVW
Download sequence
Identical sequences H3DA76
99883.ENSTNIP00000017417 ENSTNIP00000017417 ENSTNIP00000017417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]