SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017555 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017555
Domain Number 1 Region: 279-434
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.62e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000552
Further Details:      
 
Domain Number 2 Region: 435-600
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000208
Further Details:      
 
Domain Number 3 Region: 153-269
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-33
Family Spermadhesin, CUB domain 0.0000239
Further Details:      
 
Domain Number 4 Region: 41-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-32
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 5 Region: 686-799
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-19
Family MAM domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017555   Gene: ENSTNIG00000014531   Transcript: ENSTNIT00000017775
Sequence length 920
Comment pep:known_by_projection chromosome:TETRAODON8:3:6259505:6304118:1 gene:ENSTNIG00000014531 transcript:ENSTNIT00000017775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSNFPLTGATCLYLTFPSHVSASSLSFAASECGGVLDASKAGYITSPGYPLEYPSHQNCH
WIITAPEPSQRIVLNFNPHFEIERLDCKYDFIEIRDGTSDTADVLGRHCSNIAPAPIISS
GSSLQIRFVSDYAHQGAGFSLRYEIFKTGSEFCFRNFTSSSGMIESPGFPDKYPHNLECS
YMIIAPPHMDITLTFLTFDLENDPLLVGEGDCKYDWLDVWDGLPQVGPLIGRYCGTKIPP
EIQSPSGLLSLSFHTDMAVAKDGFSARYNLTRKEVSDSFHCSTTLGMESGKISDDQITAS
TTFYDNRWLPRQARLNNNDNAWTPSEDSNKEYIQVDLQFLKVLTGIATQGAISKETQKAY
YVTTFKLEVSTNGEDWMVYRHGKNHKIFHANTDPAEVVLNRVPQPVLARFVRIRPQTWKN
GIALRFELYGCQITDAPCSNLQGMLSGLLPDTQISASSSREMVWNPGTARLVASRSGWFP
GPAQPLAGEEWLQVDLGVPKMVRGVITQGARGGDAGSGATTDNRAFVRKYKVAHSLNAKD
WNFIMDSKFSLPKIFEGNTHYDTPELRHFDEVVAQFVRLYPERWSPAGIGMRVEILGCDL
PGDQKPLIRTGAPSLNCKRTTSVFPDCGRKRTPCAEDKQVMDSKPLALPSCHSCHLSFIR
QRNCTEQHTKLKSMWMYMCHRHCDSFPELNSYLYMDASLKTEQQRARLVGPVVAADTGPL
CLIFSYQLGGEAQGHLRVLSRDNHNEEAVLWTLKDDQGPVWKEGRTILPRSPKDFQVVME
GFFAHGTRGHIWIDNIQMSLSTPLTECTQPFTAFSPENPGLQVPEWNTASPSSEPPVTSV
SEKDNSWLYTLDPILVTIIVMSSLGVLLGAVCAGLLLYCTCSYSGLSSRSSTTLENYNFE
LYDGLKHKVKLNQQRCCTEA
Download sequence
Identical sequences H3DAL4
99883.ENSTNIP00000017555 ENSTNIP00000017555 ENSTNIP00000017555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]