SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017603 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017603
Domain Number 1 Region: 450-555
Classification Level Classification E-value
Superfamily Homeodomain-like 1.61e-35
Family SWIRM domain 0.0000739
Further Details:      
 
Domain Number 2 Region: 170-225,265-298
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000363
Family DNA topoisomerase II binding protein 1, TopBP1 0.056
Further Details:      
 
Domain Number 3 Region: 626-679
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000508
Family Homeodomain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017603   Gene: ENSTNIG00000014576   Transcript: ENSTNIT00000017824
Sequence length 987
Comment pep:known_by_projection chromosome:TETRAODON8:11:7454533:7460589:-1 gene:ENSTNIG00000014576 transcript:ENSTNIT00000017824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRLVAGRGAAASVPTLAARWQQGPSGCLQAKMAVRKKDGGPNVKYFEASDTVSQFDNVRV
WLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGRHVSNPPLTKLPMKCFLDFKSGGA
LCHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQQQYNCLARPVIYLSSD
IEPKLLGKLKDIIKRHQGSVTEDKASSSHVVVPIPTSLEEEEWVRPVMKRDKQVLLHWGY
FPDSYDTWIPASEVEAAVEDPPSPEKPRKVHAKWILDLDQYNEWMNEEDYEVGEGCPKRK
RISAKTLTDEVTTPDERRDKKPASAKKRKRSPSPSPTPPPQESKKKNTKKGPTAPYTKSK
RGQREEEQEDLSKDLDESSPVPASEDGNPAKTNNTKKDSDSTPVKGGTDLDEQEDESMET
TGKEEEEGSPSVKGEPVKGSDLHEDNVTEQTHHIIIPYAAWFDYNSVHAIERRALPEFFN
GKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLIN
YQVDSESRPTPMGPPPTSHFHVLADTPSSLVPLQPKTSQQTPAAQPMMSFPEKVKDKSVD
LQNFGLRSDMYSKKAGSTKSKSAASATRDWTEQETLLLLEGLEMYKDDWNKVSEHVGSRT
QDECILHFLRLPIEDPYMEDSSSSLGPLAYQPVPFSQAGNPVMSTVAFLASVVDPRVASA
AARSALEEFSRMKEEVPAALVEAHVRRVEEAARVSGRQDPLYGLEGSGIAGTGLEDGDRP
DENSDECKGDNQSNEEKREAKKDKRKRRHGAGGRGQARYDERTRNTGAAEERHENSAACK
GDNQSNEEKREAKDGLGDGYRTAGKAEKGSHEVGEGNLATAAASALAAAAVKAKHLAAVE
ERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQSFHMEQLK
YAEMRARQQHFQQIQHQQQSQTGGPHS
Download sequence
Identical sequences H3DAR1
ENSTNIP00000017603 99883.ENSTNIP00000017603 ENSTNIP00000017603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]