SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017912 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017912
Domain Number 1 Region: 865-1143
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.9e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000251
Further Details:      
 
Domain Number 2 Region: 1147-1430
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.03e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000115
Further Details:      
 
Domain Number 3 Region: 28-189
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-39
Family MAM domain 0.0000011
Further Details:      
 
Domain Number 4 Region: 392-594
Classification Level Classification E-value
Superfamily Fibronectin type III 7.98e-28
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 290-425
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000282
Family Fibronectin type III 0.0073
Further Details:      
 
Domain Number 6 Region: 192-291
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000626
Family I set domains 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017912   Gene: ENSTNIG00000014870   Transcript: ENSTNIT00000018136
Sequence length 1444
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:1882862:1961335:-1 gene:ENSTNIG00000014870 transcript:ENSTNIT00000018136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NTSLAAALWCWILIMWPSPRSAAHLQACLTGDCTFEKPLAACGYSQGRDDDLDWEQASTR
EKPSSDPWLPSDSAFMMVNTSGRFAGQKALLLTPQLKENDTHCVTFHYYIGGRDNSHPGH
LNVYIKENNSPIGMPVWNISGPATRSWLQIELAVSTYWPNFYQIVFEAVTSGQRGLLAIK
DIVVKGHQCMNTPHFLTIKGVEVNAGQTASFHCTVNGRKRDNFRLWLQQQGIGGREAPMR
STKPWNNRRFIGTFDVKNTTKGDSGRYRCIIHSEKGVGVSNYGELTIKQPPVPIAPPQLT
AVGATYLWIQLNANSINGDGPIIEREVEYRTVSGTMYDLQPVDKTTHKIGHLDPDTEYEI
SVLLTRPLEGGTGAPGPPLRAKTKCAEPMHGPRRLEVVDIQSTQVTIRWEPLGYNVTRCH
SYNLTVQYRSKVGGKEDAREEMCYDTQSRDPQHTIHNLTPFTNLSVKLVLRNPEGVMESK
ELEVQTDEDVPGAVPLESFQGSAYEEKIVLKWREPAQTYGIITQYEISYKAVSSFDPDLD
LSNQSGKVVKLGNETTHMFAGLYPGSTYSFTLRASTAKGYGPAIITQFTTKISAPSMPAY
DQETSLNQTDSTVTVLLKPAQSRGAPVSAYQVVVEEERPRRARGTAEILRCYPVPIHFQN
ATLLNSQYYFTAQFPAAGIHSPQPFTVGDNKTYNGYWNAPLLPQKSYSIYYQAVSTANGE
TKIDCVRVATKGSATHKPDAVEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLLMKKRKLA
KKRKETLNSTRQEMTVMPGHPNPSTLQRNRNHQNRSAPYQERKIVLDESQNMCSDTSSLV
QSHTHSLRKREAVDVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFFEGQSAP
WDSAKKDENRMKNRYGNIIAYDHSRVRLQALEGEQSSDYINANYVDGYHRPNRLHCYSSS
GPMQETVFDFWRMVWQENTAAIVMVTNLVEVGRVKCCKYWPDDTEIYRDVKVTLIETELL
SEYVIRTFAVEKRGAHEIREIRQFHFTGWPDHGVPYHATGLLGFIRRVKSKTMNNAGPMV
VHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAIL
EACLCGDTTIPASQLRSVYYDMNRLDPQTNSSPIKEEFRTLNMVTPTLRVEDCSIALLPR
NHEKNRCMDVLPPDRCLPFLITIDGSSNYINAALMDSYKQPSAFIVTQHPLPNTVKDFWR
LVLDYHCTSIVMLNDVDPAQLCPQYWPENGVHRHGHIQVEFVSADLEEDIISRIFRIYNA
ARPQDGYRMVQQFQFLGWPMYRDTPISKRSFLKLIRQVDKWQEEYDGGEGRTVVHCLNGG
GRSGTFCAISIVCEMLQHQRSVDVFHAVKTLRNNKPNMVDLLDQYKFCYESSSGVFELGV
TSKF
Download sequence
Identical sequences H3DBL9
ENSTNIP00000017912 99883.ENSTNIP00000017912 ENSTNIP00000017912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]