SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017922 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017922
Domain Number 1 Region: 193-395
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-52
Family DBL homology domain (DH-domain) 0.000000365
Further Details:      
 
Domain Number 2 Region: 2-234
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-37
Family Calponin-homology domain, CH-domain 0.0043
Further Details:      
 
Domain Number 3 Region: 639-769
Classification Level Classification E-value
Superfamily SH2 domain 8.99e-26
Family SH2 domain 0.00094
Further Details:      
 
Domain Number 4 Region: 381-545
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-21
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 
Domain Number 5 Region: 778-845
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-21
Family SH3-domain 0.00064
Further Details:      
 
Domain Number 6 Region: 594-668
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000868
Family SH3-domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017922   Gene: ENSTNIG00000014879   Transcript: ENSTNIT00000018146
Sequence length 847
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:2270784:2296459:-1 gene:ENSTNIG00000014879 transcript:ENSTNIT00000018146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCAMWLISCNVLPANHRVTAAAAQVFDLAQTRDGVLLCQLLNNLRPHTINLQEIN
LRPQMSQFLCLKNIRTFLASCNVAFAMKKSDLFDAFDLFDVRDFGKVMDTLSRLSYTVIA
QQGGFKPFPTEESLKDDIYNHLEDLIDENAPEDAEDLYAAVYGLEDDCTGGKIYEDLMRA
EQPPPLVLAQAEVDVRSCCLSEIKQTEEKYTGTLESIEKYFLNPLKKFISAAEIDRVFIN
IPDLVKVHKSLLVDLQDSIVNKNASNLHQIFISYKERLLIYGIYCSQVEVAIRFLDHICK
EKEDVRLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDATDKSNLKVA
LDAMKDLAQFVNEVKRDNETLREIDQYQRSIENLNQPLMAYGRPKGDSEVRMVSSVDKRR
QDRHIFLFDVAVIVCKRRGDNYEMKDILDLHFFKVTNNPTSDREVKKVCWCCGFYLTHHQ
GHTGFELFFKTREHEEEVAGTDLKCAISDIRPEKANHNCHQFKMHTFEKTTSCSFCHLLL
RGIFNQGYLCLKCGLETHKECLGQLGVCGRTGKMGALHLRHTKSARLLKRNVAEPFPGLP
RLVVIRAYSGTPSPRCGPPLSIHEGDVIELLLADLHSSWWQGKILATSKIGFFPSDAVRP
CPCVPKPVDYSSQLWFAGPMERSQAELELLERNNSTYLVRHRTRECTEYALSIKFNDKVK
HIKILTKDGCFYIAESRLFKTVLDLVEYYKQYSLKEGFSSLDTTLQVPYREPSNGSRSIS
RASSVFSPRVLGVAMARYNFLSRDAQELSLLQGDVIRVYSKLPNGWWKGEVDGRVGWFPS
TYVEEED
Download sequence
Identical sequences H3DBM9
ENSTNIP00000017922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]