SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017960 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017960
Domain Number 1 Region: 114-333
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.29e-44
Family Ankyrin repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 565-661
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-20
Family PDZ domain 0.00000513
Further Details:      
 
Domain Number 3 Region: 459-527
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-18
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 4 Region: 1679-1749
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-16
Family SAM (sterile alpha motif) domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017960   Gene: ENSTNIG00000014915   Transcript: ENSTNIT00000018184
Sequence length 1752
Comment pep:known_by_projection chromosome:TETRAODON8:3:14254829:14279062:1 gene:ENSTNIG00000014915 transcript:ENSTNIT00000018184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMMVFRIGIPDIKQTKCLRFNPDATVWKAKQQVLCSLTESLRDVLNYGLFQPATDGHDAK
FLEEERLLKEYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKASLKKFMDYIQTS
AVDKMVKFMDKGLDPNFQDSDTGETPLSLAVQCEPSGGEAIRVLVEGGAHIDFRSKDGLT
PVHKAVRGHRHTALLALLSLGASPDYKDRRGLTPLYHTVLTGGETSCCETLLYHHAKLGI
RDENGWDETHQACQHGNSQHLEHLLFYGADSASQNASGNTALHICALYNKESCARILLYR
GAKKETKNNSGQTPFQVAVMSGHFELGEIIKNHRDTDVVPFVESPKYAPQRRESARTLVV
PHPHPFLRANSDSSMNLPDWMAVPNAPGTNIVSVQVPPLTQSKLTTKKEKCKKALSTQAP
CGAPAAPGGHAHVRRPGGGLGIRRTGAGRAEDRATAAPSAGQRRRLYSAVPGRVFVATRS
HSAQGEREISFNKGDRVKVLSVGEGGYWEGTVRGRTGWFPSDCVEEVMHRSQDNRSESRG
ERAKRLFRHYTVGSYDSFDAPSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPT
PAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNSLMVKV
VMVTRNPDMDDGSRKKIPQQSKRLSTPAIALRSKSMTSELEEMVSESRRKRVCRSLMSVL
SVPSEGPGRQESCWAPSWICVQESPPYAGKNVAPCRSSGRLQNQDWSGPGKHQPGSLAHG
MQRQKSIAEAELRTELLAGRWPAGLDRHSQVPGPDDIPPPPTTAPPDPPFSSAPPPTPSP
CTLPTGAGRGLAAPAPPPLVERRIAHAAPHTAQSRTASRKVAYTGEPGGAKAAALRRGYS
TAVPASSIATVIPQQQQAAPSQPQRAERAAGAGGPKGGARRGKGPLVKQSKVEDLRTGQG
TLGDKGSVEKSSIPIPTIIVKAPSTSSSGRSSQENLDYTSQFGAAIVGAARRDRERFHEA
RRKSASLFMSAEEDGAPADNATRLRPSKSIDEACLQPSACPSTPHLLWTTSPSRCPPTSR
QPVPSTSTTFIHPLTGKALDPTSPLGLALAARERALRDDSRLRSDEGGGGVDREREGGVA
REGLRVRFSEDKTVHTHHYQPPPYQATYKERERERSRERDKEAYMGRAEPAAASDGLSQR
GAQTQPPQRPSFLRMESQSEAYILSLTPSSPPAAGAPQPASAGSGLMVLPPPAPSVDAED
EFVYADPLPPPLEFANSFDKGLAGDSTASSLTSYDSEVANLTQSAHSPCQTSPNPPAPPS
PSTLRPNATAAAPPPPSTVVDSGIEELDSRSSSDHHLDSILALSGARMDRGGAAGGRGGG
GGESERGGDFLESYMSYFDGQTFEMPSPPPTPKPAGSETGAAPATCRGRPAPPRLPTTPA
GSRRTRRRRRRARKDRPRTATGAGRPPAWRAPSRRTWSDRAPLRLYPPSPSAKPSVVNEL
SSKLQQRSKEGWSSQRPLSRHSTPAGDALRLLSPQRPSQPTALPLPAVPHHLLALPHLAQ
AQTRLPDQSPGVPVHPQSRVAQSRFAGAAARPGAQPPHLALGEPQTGAPPRPSSLPLLPT
TPLYSAISGAPPPPNSTLVVSRSLSPTHFLSGTSSPPLHPLPPPPCLSYPHLPPPSPTKP
FASKPLPYWTKYDVADWLGYLNLGEHRERFLDNEIDGTHLPSLTKDDYLDLGVTRVGHRM
NIERALRSVIDQ
Download sequence
Identical sequences H3DBR7
99883.ENSTNIP00000017960 ENSTNIP00000021112 ENSTNIP00000017960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]