SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018046 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018046
Domain Number 1 Region: 501-675,885-1024
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.19e-53
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 3615-3805
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.44e-26
Family APC10-like 0.015
Further Details:      
 
Domain Number 3 Region: 2223-2267,2348-2390
Classification Level Classification E-value
Superfamily E set domains 0.000000012
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 4 Region: 4356-4431
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000201
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018046
Domain Number - Region: 3273-3362,3569-3641,3934-3999
Classification Level Classification E-value
Superfamily ARM repeat 0.0131
Family HEAT repeat 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018046   Gene: ENSTNIG00000014997   Transcript: ENSTNIT00000018270
Sequence length 4608
Comment pep:known_by_projection chromosome:TETRAODON8:2:10521219:10561062:-1 gene:ENSTNIG00000014997 transcript:ENSTNIT00000018270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGAGADLCTTGTGMGSCPTPGAQSDCRTRYQLLLSGRALADKYRRIYTSAINDKEQGIN
QDVEGHQPIPRGKKALSKKKLKRRQKVKSKVKSRTKAECLDGALFVPDIKLHSNPSAFNV
YCNVRHCVLDWQQREASLALASRSSVQSGDSDSEEEEEFREPAVKLPKIIGIGLCGVFEL
IKETRFSHPSLCLRSLQALLDMLQGQQPEGFQTEPPDVLESLFQLLLETTVRSTGPNDPT
GQAITALSCACLFSLVVAWGDTGKILQAVSAILTNNGSHACQTIQVPTILNALQRSVQAV
LVGKIQIQDWFGNGIKRAALMNKWVLKEVAIDDDEHCLLQTDGSFLYLLCNDGLYKVGSG
YSGTVRGHVYNSTSRVRNRTEKRSWLGFAQGYLLYRDTSNHTMTAIKINPETLDPEGTVI
MPGQHGQDGQNIIFTDGEYINQIAACKDDGFVVRIYTMSSDPALQQELQLKLARKCLHAC
GISLFDLEKDLHIISTGFDEEAALIGAGREFALMKTASGKIYYTLNYHILFIIFGGPSAW
KLVEFPFTKSPNITHFXSVFFTGSASKGEDGESTKSRRQPKPYPKKMIKLETKTAVYTAC
NNGSSSIVTKDGELYMFGKDAIYSDSTCQVTDLKGHCVTQVAMGKAHTCVLTKNGEVWTF
GVNNKGQCGRDTGSMSQAGKAFGVESMATAMDEDLEDELEEKEEKSMMCQPGMHKWKLDQ
CMVCTVCGDCTGYGASCVSSGRPDRVPGGICGCGSGESGCSVCGCCKACARELDGQEARQ
RGIFDAVKEMIPLDLLLAVPVPPPPGVNIEEHIQIRQEEKRQRINRRHRLEEGRGPLVFP
GPIFMNQREQALARIRPLQALRHKRDKQKDGSSERGEKDASKITTYPPGAVRFDCELRAV
QVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGSPTLVQALPGPSVQVTAGSNHT
AVLLIDGQVFTFGSFSKGQLGRPILDMPYWNAKPSPMPNIGAKYGRKATWIGASGDQTFL
RIDEALINSHVLATSEIFASKHIIGLVPSFVSESPPFKCLLINKMDGSCRTFNDSEQEDL
QGFGLCLDPVYDVIWRFLPATREMLCYNAVIADARMSSATDLQARCSILSPELALPSGSH
ATTTRSHGALHILGCLDTLAAMQELKMGVASAEEETQAVMKVFSKEDYSVVNRFESHGGG
WGYSAHSVEAIRFCADADILLGGLGLFGGRGEYTAKIKLFELGPDGGDHETDGDLLAETD
VLAYDCAAREKYAMMFDEPVLLQLGWWYVAWARVSGPSSDCGSHGQATITTDDGVVFQFK
SSKKSNNGTDVNAGQIPQLLYRLPSNDGNASKGKQQTSEPVHILKRSFARTVSVVKECFD
SLLSILHWSWTTLVLGVEELRGLKGFQYTATLLDLERLRFVGTCCLRLLRVYICEIFPIA
ASTKAVVEESSKLAECVGKTRSLLKKILSEGMDNCLTRLDNDPQGYLSQPLTLLEAVLQE
CHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIAEANFRTSSSRLLAAVMSALCNTSVK
LTSILPIAYDGEVLLRSLVKQVSTENDSALAHRFPLLVAHMEKLSHTEENLMGMTSFREV
LEKMLVIVVLPVRKSLRKEVELFSPHLVSNTCGLLASIVSELTASALGSEVDGLNSLHSV
KTSPNRFTKTSQGRSWNTGNGSPDAICLTVDKPGVVLVGVCVYGGGGIHEYELEVLADDT
EHPGDSAHSHRWTSLELVKGTYSTDDSPSDISEIRLDKAVPLKEGVKYAVRLRNYGSRTA
NGDGGMTTIQCSDGVSFTFSTCSLSSNGTNQTRGQIPQILYYRSEYDGDLQSQLVSKANE
EDKNCSRALSVVNAVVRAAKDLLHRAFAVDVDDIPELLSSSSLFSMLLPLILAYIGPVAA
SVPKAAVEVFVLVQDLLPAVSALNQKYAPPTFNPNQSTDSTTGNQPEQGLSACTTSNHYS
VIESDHPYKQASVTQYRVSFPDCVRWTTIEFDPQCGTAQPEDVLRLLIPNRTLHLSSLGG
KPLIHDTINTWTELRKFSGSTGWPTSVLVLPGNELLFSLETASDYVKDEKACFYGFKCVA
VGYEFNPGPDEGLIMLEKELAYLGSVCAAALMKKDLALPIGNELEEDLEILEEASLQVCK
SHSGILGKGLALSHSPTILEALEGNLPLHLQTNEHSFLEDFITCVQNSSGGRLARWLQPD
SYADPQKTSLILNKDDIRCGWPATVVVQTKDQYGDVVHVPNMKVEVKAVPVSQKKSVQPD
NIKKLQRLPGNSSPSSSGPDLTFGGLPTPKLEATYEPVIVKEARYIAITMMKAYENYSFE
ELRFASPTPKRPSENMLIRANTDGTYSANWTPGAVGLYTIHVTIDGIEIDAGLEVEVKDP
PKGMIPPGTQMVKPKAEPQPSKVRKFVSKDSAGLRVRSHPSLQSDQIGVVHVNGTITFID
EIHNDDGVWLRLNDETVKKYVPSMNGYTEAWCLSFNQHLGRTLLVPADELKGQSEDSIKE
VSSCPSHEAPIRVRDRAGQGGGPGSYQVVKTGPSGHNIRSCPNLRGIPIGMLVLGNKVKA
IGEVVNSEGSWVQLDKNSVVEFCESDEGEAWSLARDRGGNQYLRHDEEQVLVEHGAQTPP
PSPFSVPAFNRPATSNGAQGFDYGLSNNKGDRGNTTSGTRPMSPASKHRQENRLPKQESR
GIRSSDQTRVKTGDGGLSAGEALILRSDTAKLRSDSHSRSHSPNHNTLQALKADGRTPGL
RTDSPNSSSRSSSPKQKMVSSSGRSSPSSTSSQNPPSTHYDKNLQAKISPSSKALLDPPR
ERSKSDSYTLDPDTLRKKKIPLTEPLRGRSTSPKPKLSPKDPNKGAITNVENRVPSPHVT
QENLHSEVVEVCTSSALLSNEDCNDENVEVHNAEDGSCKVHFSIGKAPVKEEVESRSSPK
VSRKTSSRHTRPKKDKSGPLFKGESTSRVTEPVKQAMSPSVAECARAVFAAFLWHEGIVH
DAMACSSFLKFNPDLTKEHAPIRSSLGGQGSEEKESKLKNRHSLEISSALNMFNIAPHGP
DISKMGSINKNKVLSMLKEPPLPEKCEDGKGEAISYETTSHSSMRAKSILPLTLQHLVAF
WEDISMATIKAATQNMIFPSPGSSAIPEVRPRGNLFGEMAQLAMGGPEKDTICELCGESH
PYPVTYHMRQAHPGCGRYAGGQGYNSIGHFCGGWAGNCGDGGIGGSTWYLVCDRCREKYL
REKQTAAREKVKQSRKKPLQVKTPRALPTMEAHQVIRANALFLLSLSSAAEPSMLCHHPP
RPLHSQLLPSLKEGVSDEPPNKMGCLYLQTLARQHTENFGAYPDDNLFQDEMRYLRSTSV
PAPYISVTPDACPNVFEEPESNMKSMPPSLETSPITDSDTAKRTVFQRSYSVVASEYDKQ
HSPSPARVKAVPRRRVHSGDAEVGSSLLRHPSPELSRLISAHGSLSKGERNFQWPVLAFV
IQHHDLEGLEVAMRHALRKSACRVFAMEAFNWLLCNVIQTTCLHDILWHFVASLTPSPFE
PEDEEDEENKGNKEIVEQERDLGVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSL
PSGSSLQQMALRCWSLKFKPSDHQFLHQSNVFHHINNILSKSDDGDSEESFNISVQSGYE
AMSQDLCMVTCLKDLTSVVDIRTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITINCV
KGINASNVSVHVDNSRDLGNKVTSVAFLCGKAIEDLCRIKQVDLDSRHMGWVTSELPGGD
YHVIKVELKGPENTLRVRQVKVLGWKDGESIKILGQISASMAQQKNCEAETLRVFRLITS
QVFGKLICGDAEPTPEQEEKNLLSSPEGEDKVPSDADLKEHMVGIIFSRSKLTNLQKQVC
AHIVQAIRMEATRVREEWEHAISSKENANSQPSDDDASSDAYCFELLSMVLALSGSNVGR
QYLAQQLTLMQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPVRLASIIGVKALPPADISD
IIHSTEKGDWNKLCILDMFLGCIAKALTVQLKAKGTTISGTAGMAAGKGVTTVTLPMIFN
SSYIRRGESHWWMKGSTPPQIAEIIIKLVKDMAAGHLSEAWSRVTKNAIAETIIALTKME
EEHRSPVRCIATTRLWLALASLCVLDQDHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETA
AIILCNMCGNLCTDCDRFLHLHRRTRSHQRQVFKEEEEAIKVDLHEGCGRTKLFWLMALA
DSKTMKAMVEFREHTGKPTSSSSDACRFCGTRNGTELSAVGSVCSDPDCQEYAKQACSKT
HPCGHPCGGVKNEETCLPCLHGCDKSTGCLKQDADDMCMICFTEALSAAPAVQLDCTHVF
HLQCTRRVLENRWLGPRITFGFMLCPICKNKINHSVIKDLLDPIKELYEDVRRKALMRLE
YEGLHKSEAITTPGARFHNDPAGFAMNRYAYYVCYKCKKAYFGGEARCDAEAGQGDDYDP
SELICGACSDVSRAQMCSKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSV
PKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF
Download sequence
Identical sequences H3DC03
ENSTNIP00000018046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]