SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018298 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018298
Domain Number 1 Region: 131-261
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.8e-43
Family UAS domain 0.000000402
Further Details:      
 
Domain Number 2 Region: 15-53
Classification Level Classification E-value
Superfamily UBA-like 0.000000944
Family TAP-C domain-like 0.034
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018298
Domain Number - Region: 414-443
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0393
Family UBX domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018298   Gene: ENSTNIG00000015240   Transcript: ENSTNIT00000018523
Sequence length 444
Comment pep:known_by_projection chromosome:TETRAODON8:15:6157531:6162182:1 gene:ENSTNIG00000015240 transcript:ENSTNIT00000018523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGDTTALGVNGLIRQFTAITGATESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPST
SSSSAASSSRAPPTDEVRAPIPQKQDILVEPEPLFGVPKRRRPARSIFDGFRDFQTETIR
QEQELRNGTVDKKLSTLADLFRPPIELMHKGSFETAKDCGQLENKWLMINIQNVQDFACQ
CLNRDVWSNEAVKTIIREHFIFWQVYHDSEEGQRYIQFYKLNKFPYISILDPRTGQKMVE
WNELDVTSFLEQATGFLAEHGQLDGPSCHAPPAKRARSESLIDASEDSQLEAAIRASLQE
THYESSNAPDAPDSPRSDEESDAEPFSDSEGPISFDGSDNEMPVPQEEKSSKSPYKENNH
SHKKEESKKNHLEPSSAGALHSKSKINSGGNHITAASECAGPSKISSTCDVDCLDDNGPK
ARLMLRYPDGRREQISLSSQAKLL
Download sequence
Identical sequences H3DCQ5
ENSTNIP00000018298 ENSTNIP00000018298 99883.ENSTNIP00000018298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]