SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018447 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018447
Domain Number 1 Region: 56-170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000105
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018447
Domain Number - Region: 178-254
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0837
Family Spermadhesin, CUB domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018447   Gene: ENSTNIG00000015381   Transcript: ENSTNIT00000018673
Sequence length 320
Comment pep:known_by_projection chromosome:TETRAODON8:12:3332854:3336252:1 gene:ENSTNIG00000015381 transcript:ENSTNIT00000018673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSARTQLLLFLISLLSIVGRSRFIEEDDDSDGLYSLLNMDQKRQSADFIFRRPLRCLD
MLATDGYFTFVASQPQLACAAFVIAEPDEVISLELQDVSIDCTAGDFIKIFDGWVLKGEK
FPSRQDHPLPLHQRYTDYCSSEGAGATSRSSQNVAMVFFRVHGPGSGFTLAVKKLHNPFP
CNIMSQSPEGSFTMVIPHQRRNCSFSIIYPVEIRLTALSLGQAKSNDIGLQRQVWSDCSG
SGDYVELLGGDGVDTSQMFPVADLCFSLSGLAQMKIGCDNSVVRLVSAATTSTACPFSTD
CWSSTSSPGAERTVCLTSAL
Download sequence
Identical sequences H3DD54
ENSTNIP00000018447 ENSTNIP00000018447 99883.ENSTNIP00000018447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]