SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018571 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018571
Domain Number 1 Region: 397-508
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 5.75e-27
Family FAD-dependent thiol oxidase 0.0032
Further Details:      
 
Domain Number 2 Region: 36-125
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.69e-20
Family PDI-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018571   Gene: ENSTNIG00000015500   Transcript: ENSTNIT00000018798
Sequence length 742
Comment pep:known_by_projection chromosome:TETRAODON8:1:15810369:15837161:1 gene:ENSTNIG00000015500 transcript:ENSTNIT00000018798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRKCERNIRPPPHKVLLLLWICLLLPSAAEAGLYSLSDQIILLNAKSVESVLVNSTAAI
VAEFYASWCGHCVAFSPVYKTLARDIKEWKPAVDLAAVDCAAMETRQVCLDYGVKGYPTI
KFFHAYSKDGSRGLPLKDFPRDVRRLRHRIIDQLEKHPEQWPPACPPLEPISQAEVDAFF
QTNSVEHLALIFEDDKSYIGREVTLDLLQFENIAVRRVLSTQKELVTRLGVTDFPSCYLY
YSGGNFTRLQVNMEARTFYSYALQRLPGVVRAGIPRPGRAHLLWTVLTFPRWHRSRVYMA
DLESTLDYSLRVELASSGAFRRSQSLPLLKKSACFAHKYFPGRPMVMNLLQSLNTWLQDQ
SGDEISYEELKKRLDSTAQTPNAALPEGARWVACQGSQPHLRRFPCGVWTLFHVSYRPSK
KRRRRSPGSFQGPDPQEVLSAMRSYVRHFFGCRPCAQHFEEMAEESLSELSTLSAAVLWL
WSRHNRVNNRLAGDLSEDPNFPKIQWPPPEMCPTCHSLRENGEHRWNQDQVLAFLVSYYS
ANNILTAQPTALSEEEEEEVQDEAAARREAEGGEEATAGEMTGKVSAPTTWAKHEMMGEG
RPPFRRRPSIVGMKMREKREDIRTLQRKEEPEPGPVFGLGMELDAGLGMVGLQPLEEDFD
PDLQQQAKRRQKRELGSRYSSEEAEWSRRRAWMSVLSIGFTRADVSLCVVLYFLSSVCLL
AMYLFFKSRLKEVKGHMRRPTS
Download sequence
Identical sequences H3DDH8
ENSTNIP00000002014 ENSTNIP00000018571 99883.ENSTNIP00000018571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]