SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018599 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018599
Domain Number 1 Region: 2280-2353
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.06e-19
Family TB module/8-cys domain 0.00047
Further Details:      
 
Domain Number 2 Region: 2073-2201
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-18
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 656-798
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 2395-2522
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-17
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 5 Region: 389-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.27e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 892-960
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.83e-16
Family TB module/8-cys domain 0.00073
Further Details:      
 
Domain Number 7 Region: 969-1103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.47e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 1789-1915
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.26e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 9 Region: 789-873
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.62e-16
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 10 Region: 1627-1693
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.62e-16
Family TB module/8-cys domain 0.00049
Further Details:      
 
Domain Number 11 Region: 1468-1540
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.42e-16
Family TB module/8-cys domain 0.0000456
Further Details:      
 
Domain Number 12 Region: 597-670
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000119
Family TB module/8-cys domain 0.00086
Further Details:      
 
Domain Number 13 Region: 127-212
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000392
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 14 Region: 1997-2091
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000523
Family TB module/8-cys domain 0.0003
Further Details:      
 
Domain Number 15 Region: 273-336
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000824
Family TB module/8-cys domain 0.0031
Further Details:      
 
Domain Number 16 Region: 1344-1477
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 17 Region: 1221-1358
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000698
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 18 Region: 168-284
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 19 Region: 2521-2636
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000534
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 20 Region: 1099-1234
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000847
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 21 Region: 521-602
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000121
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 22 Region: 2181-2282,2338-2394
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000126
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 23 Region: 1546-1601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.00051
Further Details:      
 
Domain Number 24 Region: 1949-1996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000101
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 25 Region: 1702-1747
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000839
Family EGF-type module 0.0029
Further Details:      
 
Domain Number 26 Region: 1749-1803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 27 Region: 1908-1951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000503
Family EGF-type module 0.006
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018599
Domain Number - Region: 98-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00162
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 65-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0361
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018599   Gene: ENSTNIG00000015528   Transcript: ENSTNIT00000018826
Sequence length 2816
Comment pep:known_by_projection chromosome:TETRAODON8:1:16229217:16255293:1 gene:ENSTNIG00000015528 transcript:ENSTNIT00000018826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQLSPSCGSGA
ASTVQSCNIRCMNGGSCAEDSCTCPKGYTGSHCGQPVCENGCQNGGRCIGPNRCACVYGF
TGPQCERDYRTGPCFTQVSHQMCQGQLSGIICTKTLCCATIGRAWGHPCEQCPAQPHPCR
RGFIPNIRTGACQDVDECQAVPGLCAGGNCINTVGSYECKCPAGHRQSDTSHKCEDIDEC
STIPGVCDGGECTNTAGSYVCSCPRGYISSTDGSRCVDQRVGTCFSALANGRCAAELNGQ
YTKMQCCCDTGRCWALGQIPEMCPVRGSGKYETIRPAYTNPPVKTAVQADPLSGPSRPAG
VQASMHRGRPPRTRHPQRLPQCSASVNESIDVCKHFTNLCLNGRCIPIHASYRCECNMGY
KQDVRGECIDVDECVSNPCINGDCVNTPGSYHCKCHEGYQGTPTKQACIDIDECIVNGVM
CRNGRCVNTEGSFQCICNAGFELTPDGKNCIASPAQDHDECATTNMCLNGMCINEDGSFK
CICKPGFALAPNGRYCTDIDECQTPGICMNGRCINSEGSFRCECPPGLAIGMDGRVCVDT
HMRTTCYGAIKMGTCSRPFPGAVTKSECCCADPEHGFGEPCYPCPSRNSAEFQALCNSGI
GITADGRDINECALDPDICLNGICENLRGSYRCICNIGYESDTSGKSCVDINECLVNRLL
CDNGLCRNTPGSYTCSCPKGFIFKPDSETCEDINECLSSPCVNGVCRNVAGSFNCECSLG
SKLDSTNTICVDSMKSTCWLTIQDSRCEVNINGATLKSECCSTLGAAWGSPCEPCEIDTS
CSRGFARMKGLVCEDINECEVFPGVCTNGHCVNTQGSFRCECAEGLTLDSTGRTCVDLRS
EQCYLKWHEDECGEPLPGRYRVDMCCCTVGAAWGVDCEECPKGSPEFRAICPRGNGFANR
GDILTGRPFYKDVNECKVFQSLCTYGNCRNTIGSFKCRCNSGFALTAEERNCTDIDECRI
SPDLCGPGTCVNTPGSFECECFEGYESGFMMMKNCMDIDECERNPALCHGGTCLNTEGSY
ECECPTGHSLSADGSSCEDVNECQLSENLCKNGQCVNMAGTFQCSCDTGYQATPDRQSCV
DIDECTIMNGGCETHCTNSEGSYECSCSEYALMPDLRTCADIDECEETPDICDGGQCTNI
PGEYRCLCYDGFMASMDMRTCIDVNECDLNPNICLHGDCENTKGSFICHCQLGYFVNKGS
TGCTDVDECEIGAHNCAMHAACINVPGSFKCRCRDGWVGDGIECLDQDECAGEDHNCNLN
ADCLNTPGSYRCACKDGFVGDGFSCSDMDECADNVNLCENGQCLNAPGGYRCECEMGFTP
TEDSRACQDIDECNFQNICVFGSCQNLPGMFRCVCDDGYELDRSGGNCTDINECADPMNC
INGLCVNTPGGYMCNCPEDFELNPTRVGCVDTRVGNCFLDTNIRGDGGISCSLEIGVGVT
RASCCCSLGGAWGNPCELCPPSNSSEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQ
GGICINTFGSFQCECPAGYYLNEETRVCDDIDECVSSIGICGPGTCYNTQGNYTCVCPPE
YMQVNGGNNCMDMRKSVCYRNFNDTCENELSFNMTKMVCCCSYNVGKAWNKPCEACPAPA
SSDYRVLCGNQAPGFIIDIHTGKPIDIDECRDIPGLCAHGVCINQIGSFRCECPMGFSYN
NILLICEVDIDECSSGDNLCQRNANCINIPGSYRCQCSPGFKLSPNGACVDRNECQEIPN
VCSHGSCIDTQGSYRCACHNGFKATADQSMCMDIDECDRQPCGNGTCKNTVGSYNCLCFP
GFELTHNNDCMDIDECSALQGQVCRNGQCINGLGFFQCFCHEGYENTPDEKNCVDVNECV
RLPGTCSPGTCQNLDGSFRCICPPGYEVQNDQCIDINECEVESNTCQFGTCTNTPGSFQC
TCQPGFVLSDNKRRCYADTRESFCFTKFDAGKCSVPKALNTTKAKCCCSKMPGEGWGLPC
ELCPRSNEVSSGLQNSMSYGLGSVIGPLNREVDTNECLDNPGVCQNGICINTDGSFRCEC
TFGYNLDYTGVKCVDTDECSIGNPCGNGTCTNVVGGFECLCQEGFEPGPMMTCEDVNECS
QNPLLCAFRCVNTFGSYECMCPDGYVLRDDQRMCRDQDECSEGLDDCDSKGMTCKNLIGT
FMCICPPGMQRRPDGEGCTDLNECRAKPGICSNGRCVNTVGSYRCECNDGFEPSATGTEC
IDNRQGYCYTEVLQTMCQQSSTSRISVTKSECCCNVGRGWGSQCELCPLPGTVHFKKMCP
LGPGYTTDGRDINECQVLPDLCRNGQCVNTIGSFRCHCNVGYKADFTSTSCVDLDECALS
PKPCNFLCKNTEGSYLCSCPRGYSLQPDGKTCRDVDECSTKQHNCQFHCVNTIGGFTCKC
PTGFTQHQTACIDNNECAGPNSGCGSRASCVNTPGSFSCECSKGFSLDSSGMECEADVDE
CSNNHRCQHGCQNMLGGYRCGCPQGYVQHYQWNQCVDENECQGGSCRSASCYNTLGSFKC
VCPSGFDFDQTAGGCQDVNECSAGGNPCIYGCSNTDGGYLCGCPGGFYRAGQGHCMSGSG
FTGQFTEGDEEDSLSPEACYECKINGGGKNGRHKRSAGENGLKQAREAQEQHSAVSMASV
DTQDAIPMNVSLSSLLNKEPLLELLPALQPLENHVRYVITHGNANEHFRLLERRDGKSVL
RLGKRPPLPGSYRLEIASLRLFGPRRLHQLERQHDNDYLQGEIGDALRIKLNIHVH
Download sequence
Identical sequences H3DDK6
ENSTNIP00000018599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]