SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018796 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018796
Domain Number 1 Region: 79-247,323-434
Classification Level Classification E-value
Superfamily L domain-like 1.56e-38
Family Ngr ectodomain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 708-890
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.47e-34
Family Laminin G-like module 0.0069
Further Details:      
 
Domain Number 3 Region: 549-677
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000643
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 479-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000198
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 5 Region: 521-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000175
Family EGF-type module 0.023
Further Details:      
 
Domain Number 6 Region: 938-975
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000816
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 977-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000745
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018796
Domain Number - Region: 1-37
Classification Level Classification E-value
Superfamily L domain-like 0.00347
Family Ngr ectodomain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018796   Gene: ENSTNIG00000015721   Transcript: ENSTNIT00000019024
Sequence length 1097
Comment pep:known_by_projection chromosome:TETRAODON8:1:5623501:5656692:-1 gene:ENSTNIG00000015721 transcript:ENSTNIT00000019024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTVHLAQNPFMCDCHLKWLADYLFDNPIETSGARCSHPRRLANKRISQVKGKKFRCTGQE
DYRSRLNGECFQDLVCPEKCRCEGTVVDCSNLKLTRVPPHIPEHTTDLRLNDNEIVVLEA
AGIFKKLPNLKKINLSNNKLRDIREGAFDGASGVLELLLTGNKLTGLQGRMFRGLNGLKT
LMLRSNAVKCISLTSLSGFSRSPLLDFYLMHIFMQFSEPKLIRIHNLLSNPYVCDCHLAW
LGHWLKKTRVVSGNPRCQKPAFLKEIPIQDVATPDFTCDDGNIYSPHTPAVMVCVGFFSF
SCFSHLSPYMLHIIHKALTQLIIYLEGNMLTSVPKELAGMKQLSLVDLSNNSISTLAPFT
FSNMTQLATLILSYNQIRCIPVYAFDGLKALRLLTLHGNDLSTIPEGAFNHLTSLSHLAL
GANPLYCNCEMRWLSQWVKAGFKEPGIARCTGPPEMADRLLLTTPLNKFQCKGPTDLSLL
SKCAPCLGAPCQNNGTCVSDATGSYLCMCPYGFKGQNCEIPINACISLPCSNGGTCHVQP
GHEDHFSCVCPPGFEGHRCETNPDDCEDNDCENNSTCVDGVNNYTCVCPPNYTGDLCDEV
IDPCLHGFDPCQQDSKCVRVGRSYRCECLPGYVGQQCEQDYNDCLENKCQHGAECVDAVN
GYICVCKEGFSGLFCENPPPMILLQTSPCDQSDCQNGAQCLVVAGEPVCRCTPGFYGSKC
DKISTVHFLGRDAFVELPGAKLRPTAHISLQVATEKDNGILLYKDDHDPLALELYQGHIR
LIYDFANYPPTTVYRCDSVESMNDGLFHTVELLIQNRSLSLVVDNGAQKSLGKLARQPSV
DHNTHLYIGGAPSQVVASGLRAGPERSPQAFNGCIHNVRINGEAQDLMVFHPQSDGVLAG
CHSCSICAQGTCKEGGETGVTCDCPPGHDRAFCAQTTGPNPCLDNRCSHGQCVPNGHSYS
CKCSEGYQGQYCDQQQEPPACRGQRCWNGECRLSESGAPICHCQPGYTGPTCDTEFTCQG
EMVREQLKRHQALRTCTSTSKIPRMDCPRSCQAAAPAGVCCGVTKSRRRKVVFRCTDGTS
YSEEMETALECGCSQCP
Download sequence
Identical sequences H3DE53
ENSTNIP00000018796 99883.ENSTNIP00000018796 ENSTNIP00000018796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]