SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018860 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018860
Domain Number 1 Region: 36-250
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.7e-34
Family Ankyrin repeat 0.00087
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018860
Domain Number - Region: 273-314
Classification Level Classification E-value
Superfamily SOCS box-like 0.000109
Family SOCS box-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018860   Gene: ENSTNIG00000000074   Transcript: ENSTNIT00000019088
Sequence length 319
Comment pep:known_by_projection chromosome:TETRAODON8:1:3873432:3874623:1 gene:ENSTNIG00000000074 transcript:ENSTNIT00000019088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLILGQAVNMSLMDISKIFSLLQPKEEDERSERSQALNAAVSADDVVLLSDLLSQESYRK
AVNARSGWGIPVTPLRTAAALGHLRCLEVLLEHGAEVDSLDVKAQTPLFTAVSGKHLDCV
VALLKAGADPNGSQYNNCSPVLTAAREGDVDVLRELLRFGAEADVKPKVPEWATATACRG
PLYISAVYGHLDCFKLLLLHGANPDYNCTDEKMLARIKQPKTVLETCFHYGCGEEYVQLL
VDFGADVYLPTLIVDKFMKQNEALALLLKERVCPKTLMTQARLSIRRYIKLPDKEAGIDW
LDLPQMLRNYLKHNTTELL
Download sequence
Identical sequences H3DEB7
ENSTNIP00000018860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]