SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019026 from Tetraodon nigroviridis 76_8

(show help)
Strong hits

Sequence:	ENSTNIP00000019026
Domain Number 1	Region: 99-165
Classification Level	Classification	E-value
Superfamily	Kazal-type serine protease inhibitors	0.00000000000141
Family	Ovomucoid domain III-like	0.00029
Further Details:

Domain Number 2	Region: 263-317
Classification Level	Classification	E-value
Superfamily	Kazal-type serine protease inhibitors	0.0000000000043
Family	Ovomucoid domain III-like	0.0073
Further Details:

Domain Number 3	Region: 192-240
Classification Level	Classification	E-value
Superfamily	Kazal-type serine protease inhibitors	0.0000000000388
Family	Ovomucoid domain III-like	0.012
Further Details:

Domain Number 4	Region: 27-70
Classification Level	Classification	E-value
Superfamily	TB module/8-cys domain	0.0000942
Family	TB module/8-cys domain	0.0056
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSTNIP00000019026 Gene: ENSTNIG00000015939 Transcript: ENSTNIT00000019254
Sequence length	320
Comment	pep:known_by_projection chromosome:TETRAODON8:12:5821919:5824709:-1 gene:ENSTNIG00000015939 transcript:ENSTNIT00000019254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MFGMLKHHLHPGVLLFFVWLCHLMEHQKVQAGNCWLQQGKNGRCQVLYMPGMSREECCRS GRLGTSWTEEDVPNSTLFRWMIFNGGPNCIPCKETCDNVDCGPGKRCKMNRRSKPRCVCA PDCSNITWKGPVCGTDGKTYKDECALLKAKCKGHPDLDVQYQGKCKKTCRDVLCPGSSTC VVDQTNNAYCVTCNRICPEVTSPEQHLCGNDGIVYASACHLRRATCLLGRSIGVAYEGKC IKAKSCEDIQCSAGKKCLWDARMSRGRCSLCEETCPESRTDEAVCASDNTTYPSECAMKQ AACSLGALLEVKHAGSCNCK
Download sequence
Identical sequences	H3DET3 ENSTNIP00000019026 ENSTNIP00000019026 99883.ENSTNIP00000019026

SEARCH