SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019244 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019244
Domain Number 1 Region: 218-361
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-39
Family Third domain of FERM 0.00000203
Further Details:      
 
Domain Number 2 Region: 106-217
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-35
Family Second domain of FERM 0.00000207
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-24
Family First domain of FERM 0.000016
Further Details:      
 
Domain Number 4 Region: 511-601
Classification Level Classification E-value
Superfamily Moesin tail domain 4.84e-17
Family Moesin tail domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019244   Gene: ENSTNIG00000016153   Transcript: ENSTNIT00000019473
Sequence length 601
Comment pep:known_by_projection chromosome:TETRAODON8:7:8053684:8057435:1 gene:ENSTNIG00000016153 transcript:ENSTNIT00000019473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPGPNIVKMSILGLKKKQPKTFKVKVITMDAEMEFSCEVKWKGKDLFDLVCRTVGLRETW
FFGLRYTIKDTYAWLKQEKRVLEQEVPKDSPITFHFLAKFFPEKVEEELVQEITQHLFFL
QVKKQILDEEIFCSPEASVLLASYAVQAKYGDYDPNFHKPGFLAQDELLPKRVLMQYQMT
ADMWEEKITAWYAEHRGIASLNRDEAEMEYLKIAQDLEMYGVSYFAITQNKRDTDLLLGV
DAQGLHIYSPNSKLSPNKSFPWSGIRNISYSEKEFTIKPLDKKKDVFKFYSSQLRVNKLI
LQLCIGNHDLFMRRRKVDSIEVQQMKAQAKEEKARKKMERQILAREKQMREEAERAKEEM
ERRLFQLQDEARLANEALLRSEETADLLAEKAQIAEEEAKLLAHKAAEAEQERQRLEVTA
MKTKEEKRLMEQKMREAEQLAVKLVEQSERRLKEADHLKQDLTEAKDAERRAKQKLLEIT
KTTYPLIAAYSTPPAPLAAPEAPDLPYDSGRLDFKDSDMKRLSMEIERERLEYMEKSKHL
QDQLKELKTEIESLKLEEQQQQAGLYSLRGDTRGYVQEPVYIPHSNRNSAYMSQMAFFEE
V
Download sequence
Identical sequences H3DFF0
ENSTNIP00000019244 99883.ENSTNIP00000019244 ENSTNIP00000019244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]