SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019546 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019546
Domain Number 1 Region: 32-175,207-269
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.07e-50
Family BAR domain 0.00000988
Further Details:      
 
Domain Number 2 Region: 508-583
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-16
Family SH3-domain 0.0000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019546   Gene: ENSTNIG00000016448   Transcript: ENSTNIT00000019776
Sequence length 584
Comment pep:known_by_projection chromosome:TETRAODON8:2:15325130:15332921:-1 gene:ENSTNIG00000016448 transcript:ENSTNIT00000019776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELNLGKGLTAGKVASNVQKKLTRAQEKVLQKLGKADETKDAAFEEGVINFNKQYAEGS
KLQRDLRAYLEAVKAMHESSKNVQACLADMYEPEWYGKNEVDSIVEDCDVLWTDYHQKLV
DHALISMDTYLGQFPDIKARIAKRDRKLVDYDSARHNYAITHKTKKKDGGIKITKPSSLL
ERATPGWAQGLLSAHNVAQSSLSRSQAEEELERAQKVFEEINIDLQEELPSLWNSRVGFY
VSTFQSLAGFEEKFHKEIGRLDQDLYDILEKLEGTDTSGLKSNNWSNVVLSGNKCSTDLK
PTPCLQKDSVKEASNHTLRPGGPPPIPKSPSRLKPAVPPPPKVTPSKDMKAENIVNLFDA
AAAPDISVTSPTEFDRPAVSSLLDVDLDSFTSTVTETEFQNQGWHFVTELGETCSSTVAA
RSGATPPLLQSSFSLSPSDHSDADDTEPVAEAQEGWGDDGSQPVTEEETPAAEATEEESV
QAATAMDGEEGQPPAAAAQPTEEASEAIEMPPGFLFKVQVMHDYAPNDTDELEMKAGDVV
LVIPFENPDEQDDGWLMGMKQHDWQQNKENAAKGVFPENFTQRL
Download sequence
Identical sequences H3DGA2
ENSTNIP00000019546 99883.ENSTNIP00000019546 ENSTNIP00000019546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]