SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019594 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019594
Domain Number 1 Region: 15-161
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-28
Family C-type lectin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019594   Gene: ENSTNIG00000016495   Transcript: ENSTNIT00000019824
Sequence length 216
Comment pep:known_by_projection chromosome:TETRAODON8:2:14374186:14375807:1 gene:ENSTNIG00000016495 transcript:ENSTNIT00000019824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLKKKLPFLLLSFIHLQLTLSGDCPADGRTWVPFQDKCYHFVHGAEDQLKSYTYERARSL
CLGFELLSIQSAEENDFAVNYSPDVWKGTVNVWLGMYFDTNSDSLRWSDDSAVKFTNWED
GFSPDLPPMETCAVLHSNTGKWEKVSCLDEVENGVVCEAKQGMPEAEKVKQKSSLVLSTL
VILSVIAVVGVSAGIWCLYQRQNPGSNIFTAFEYHP
Download sequence
Identical sequences H3DGF0
ENSTNIP00000019594 ENSTNIP00000019594 99883.ENSTNIP00000019594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]