SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020109 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020109
Domain Number 1 Region: 268-539
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-82
Family Protein kinases, catalytic subunit 0.000000000606
Further Details:      
 
Domain Number 2 Region: 124-246,274-301
Classification Level Classification E-value
Superfamily SH2 domain 7.46e-40
Family SH2 domain 0.0000056
Further Details:      
 
Domain Number 3 Region: 93-133
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000759
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020109   Gene: ENSTNIG00000016986   Transcript: ENSTNIT00000020340
Sequence length 547
Comment pep:known_by_projection chromosome:TETRAODON8:21:1136273:1140747:-1 gene:ENSTNIG00000016986 transcript:ENSTNIT00000020340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCACCKQKKPANGTDPSPSNPDGGLSAALTQGRYGPDPTQTIPDYNKGFSSSAIFPSIN
THQRPGGLTGTTPVPATIAVPRCVCVCANAGGGVTLFIALYDYDARTEDDLSFRKGEKFH
IINNTEGDWWEARSLDTGNSGYIPSNYVAPVDSIQAEEWYFGKMGRKDAERQLLAHGNQR
GTFLIRESETTKGAYSLSIRDWDDNKGDHVKHYKIRKLDNGGYYITTRSQFDTVQQLVEH
YTERAAGLCCRLIGSCKRGMPKLADLSVKTKDMWEIPRESLQLIKKLGNGQFGEVWMGMW
NGTTKVAVKTLKPGTMSPEAFLEEAQIMKRLRHDKLVQLYAVVSEEPIYIITEFMSQGSL
LDFLKDGEGQNLKLPQLVDMAAQIASGMAYIERMNYIHRDLRAANILVGDNLVCKIADFG
LARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELITKGRVPYPGM
NNREVLEQVERGYRMACAPGCPASLHELMLQCWRREPDERHTFEYLQSFLEDYFTATEPQ
YQPGENL
Download sequence
Identical sequences H3DHW5
ENSTNIP00000020109 ENSTNIP00000020109 99883.ENSTNIP00000020109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]