SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020251 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020251
Domain Number 1 Region: 272-542
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-78
Family Protein kinases, catalytic subunit 0.000000000346
Further Details:      
 
Domain Number 2 Region: 160-303
Classification Level Classification E-value
Superfamily SH2 domain 7.57e-36
Family SH2 domain 0.00000641
Further Details:      
 
Domain Number 3 Region: 96-170
Classification Level Classification E-value
Superfamily SH3-domain 6.01e-23
Family SH3-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020251   Gene: ENSTNIG00000017116   Transcript: ENSTNIT00000020482
Sequence length 550
Comment pep:known_by_projection chromosome:TETRAODON8:6:5334782:5339931:-1 gene:ENSTNIG00000017116 transcript:ENSTNIT00000020482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKEEKGSAMKYCPDNSMMADPSSTAAASQMGHYGPDPTQLQNQVPSSSSGNLGVN
FNHTITPFGGSSSAMTPFGGVSSSFTGPVSNSFSGAVSSGVTFFVALYDYEARTSDDLSF
TKGDRFQIINNTEGDWWEARSITTGRGYIPSNYVAPADSIQAEEWYFGKMGRDAERLLLI
PGNHRGTFLVRESETTKGAYSLSIRDWEEAKGDNVKHYKIRKLDSGGYYITTRVQFDALQ
KLVKHYTEHADGLCHRLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMG
TWNGTTKVAIKTLKTGTMSPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEYMAKA
GSLLDFLKEGDGKFLKLPLLVDMAAQIADGMAFIERMNYIHRDLRAANILVGDNLVCKIA
DFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPY
PGMVNREVLEQVERGYRMPCPQGCPESLHEMMKLCWKKDPDERPTFEYLQSFLEDYFTAT
EPQYQPGENL
Download sequence
Identical sequences H3DIA7
99883.ENSTNIP00000020251 ENSTNIP00000020251 ENSTNIP00000020251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]