SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020356 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020356
Domain Number 1 Region: 258-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-81
Family Protein kinases, catalytic subunit 0.000000000533
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-40
Family SH2 domain 0.00000276
Further Details:      
 
Domain Number 3 Region: 80-195
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-27
Family SH3-domain 0.0000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020356   Gene: ENSTNIG00000017219   Transcript: ENSTNIT00000020587
Sequence length 536
Comment pep:known_by_projection chromosome:TETRAODON8:10:8670604:8677300:1 gene:ENSTNIG00000017219 transcript:ENSTNIT00000020587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEAAKLTDDRETSLSHHSGYRYGSDPTPQHYPSFGVTTIPNYNNFHGAATQG
VTVFGGVHTSSQSGTLRSRGGTGVTLFVALYDYEARTEDDLSFRKGERFQILNSTEGDWW
EARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSNGNARGTFLIRESET
TKGAYSLSIQDWDDIKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSARAAGLCC
RLIVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGTTKVAVKT
LKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGR
GLKLPNLVDMAAQVAAGMAYIERMNYIHRDLSANILVGDSLVCKIADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVER
GYRMPCPQDCPTSLHELMVQCWKKDPEERPTFEYLQAFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences H3DIL2
ENSTNIP00000020356 ENSTNIP00000020356 99883.ENSTNIP00000020356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]