SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020358 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020358
Domain Number 1 Region: 258-469
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-67
Family Protein kinases, catalytic subunit 0.0000000101
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-40
Family SH2 domain 0.00000276
Further Details:      
 
Domain Number 3 Region: 79-195
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-27
Family SH3-domain 0.0000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020358   Gene: ENSTNIG00000017221   Transcript: ENSTNIT00000020589
Sequence length 469
Comment pep:known_by_projection chromosome:TETRAODON8:10:8653301:8659457:1 gene:ENSTNIG00000017221 transcript:ENSTNIT00000020589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEAAKLTDDRETSLSHHSGYRYGSDPTPQHYPSFGVTTIPNYNNFHGAATQG
VTVFGGVHTSSQSGTLRSRGGTGVTLFVALYDYEARTEDDLSFRKGERFQILNSTEGDWW
EARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSNGNARGTFLIRESET
TKGAYSLSIQDWDDIKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSARAAGLCC
RLIVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGTTKVAVKT
LKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGR
GLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELVTKGRVPYPG
Download sequence
Identical sequences H3DIL4
ENSTNIP00000020358 99883.ENSTNIP00000020358 ENSTNIP00000020358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]