SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020381 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020381
Domain Number 1 Region: 905-1199
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000711
Further Details:      
 
Domain Number 2 Region: 215-358
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-31
Family Third domain of FERM 0.003
Further Details:      
 
Domain Number 3 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-28
Family Second domain of FERM 0.00047
Further Details:      
 
Domain Number 4 Region: 23-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-18
Family First domain of FERM 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020381   Gene: ENSTNIG00000017244   Transcript: ENSTNIT00000020613
Sequence length 1203
Comment pep:known_by_projection chromosome:TETRAODON8:10:7957118:7965131:1 gene:ENSTNIG00000017244 transcript:ENSTNIT00000020613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVTRIQLLNGEFVEFTLSVESTGQECLEAVAQRLEVRE
ITYFSLWYFNKQNQQRWIDLEKPLKKQLDKYGLEPTVYFGVVFYVPSVVQLQQEITRYQY
YLQLKKDVLEGRISCSLEQAIRLASLAVQADFGDFNRYDSQDFLQKFVLFPIDWIQDERT
LEEATQKVALLYQSFRGLPASEAEMLYMQEVEKMEGYGQESFQAKDSTGTDVTLGSCLDG
IIVKHKNGRPLVLFRWNEINNMSHNRSFLVVELTNREESVQFQTEDMETSKYVCRMCLAR
LKFYKINMSSLQTQPAVINPVRRRSSTRISLPKPQAYMMPPPQLHYNGHFTEPYTSSQDN
LYMNNHNGYYYHSQTSLDCAPLEYGTGGRLRNGSVYSAHSTSSLTNPQHYMQPSPMSSNP
SITSDITRPDYVPSHRHSALIPPSYRATPDYETVMRQKARGPGGGMVSSQDHRQSHSMRN
LNIGNSYAYSRPDPLVYSQPEIRVGHGGTNQHHHYPFHLGSSFHSPSPYPHPTERRPVVG
AVSVPELTNVQLQQAQEYPAPNIMRTQVYRPPPPYPYAHPRPANSTPDLSRHLYVSSSNP
DLVITRRVHHSVQTFQEDSLPVAHSLQEVSEPLFSGAPQRHLYNTQKRNSIELAGLEHSL
EGMRLKERTVSSSAAETATPPPVLRGGRSQGSQLNVFLEHPKKEEVKESIQYGHKKSLSD
ATMLVHSSGEEEELEDDGGRHTPLSQEAAAAALAPEQPSQPHPGLTALPSLPEQQQNPAE
PPPAYPIGSCLEPSITSSITYKVHPMIQESEPLYLLSDLRQASIIPSISEGDLSSQAKQK
TKKEVKKRPVSELPPGKKAVEGLPPPGMKKGPRAEVKKMGPLKMAHLNGLSVSRQPVYSD
TKDEPERASNDERCKLLEQHMERGELLKEYESIPRRHPAGECTVAQLPESSDKNRFHDVL
PYDSTRVELVPTKENNTGYINASHIKLTAGGQEWNYIASQGPLSNTCQDFWQMVWEQGVS
IIAMVTAEEERGREKSYRYWPRLGSRHNTVTYGRFKITTRFRTESGCYATTGLKLKHLLT
GQERTIWHLQYTDWPDHGCPDDLKGFLTYLEEIQSVRRHTNSISDPKNTNLPVLVHCSAG
VGRTGVVILSEILIACLEHNQMLNIPNVLLKLRAQRMMVVQTFAQYSFIYKVLIHYLRNS
RLI
Download sequence
Identical sequences H3DIN7
ENSTNIP00000001310 99883.ENSTNIP00000020381 ENSTNIP00000020381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]