SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020756 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020756
Domain Number 1 Region: 239-503
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-78
Family Protein kinases, catalytic subunit 0.0000000038
Further Details:      
 
Domain Number 2 Region: 125-268
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-34
Family SH2 domain 0.0000105
Further Details:      
 
Domain Number 3 Region: 61-175
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-21
Family SH3-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020756   Gene: ENSTNIG00000017609   Transcript: ENSTNIT00000020989
Sequence length 513
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:20117025:20127050:1 gene:ENSTNIG00000017609 transcript:ENSTNIT00000020989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGRMGCIKSRLDGGVSKGVEEKSSPQTVRTQLARYVRDPTSDINHNINNSLLPGQRFQTL
EEKGVEKIVIALYPYEALHPDDLGFKKGERMKILEERGEWWRAKSLSTNREGFIPSNYVG
QADTMETEDWFFKDISRKDAERQLLAPANRAGSYLIRESETAKGSFSLSVRDVDDGGTDL
VKHYKIRLLDNGGYYISPKISFTDISSMIKHYHSKADGLCRKLDRPCVKPKAEKPWDKDA
WEISKDSIRMVKRLGAGQFGEVWMAYYNNITRVAVKTLKPGTMTVEAFMDEANLMKKLQH
DRLVRLYAVVTKTEPIYIITEYMANGSLLDFLKSDLGCSLQIPKLIDFSAQIAEGMAYIE
RRNYIHRDLRAANVLVSECLLCKIADFGLARVIEDDEYSAREGAKFPIKWTAPEAINYGS
FTIKSDMWSFGVLLYEIITYGKIPYPGMTKGEVISSIQRGYRMPQPDSCPSELYHMMLDC
WKDKPDARPTFEYMQSVLNDFYTATESQYQQQP
Download sequence
Identical sequences H3DJR0
ENSTNIP00000020756 ENSTNIP00000020756 99883.ENSTNIP00000020756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]