SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020787 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020787
Domain Number 1 Region: 147-457
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.09e-122
Family Transglutaminase core 0.0000000151
Further Details:      
 
Domain Number 2 Region: 3-146
Classification Level Classification E-value
Superfamily E set domains 3.01e-48
Family Transglutaminase N-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 473-583
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.05e-28
Family Transglutaminase, two C-terminal domains 0.00072
Further Details:      
 
Domain Number 4 Region: 584-683
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.97e-27
Family Transglutaminase, two C-terminal domains 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020787   Gene: ENSTNIG00000017639   Transcript: ENSTNIT00000021020
Sequence length 684
Comment pep:known_by_projection chromosome:TETRAODON8:1:12022207:12028594:-1 gene:ENSTNIG00000017639 transcript:ENSTNIT00000021020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRVRSVDLMKSREGQNRSKHHTHLYQTDAFIIRRGQNFQMWLGLSRPFDPKEDKLHLILK
TGPLPTVSKGTQVNVPLVKNLEDGCWGAAVVKQEGNRIHLSVNSSATAAVGRYQLTVETT
CTGGHAVSTHHPDNDVYILFNPWCEEDTVFMDSEEERQEYVLNDVGRIYYGTQHQIGERT
WNYGQFDDGILAICLFVLEKSGTPPSGWGDPVNVVRVISAMINSPDDSGVLEGNWSGNYS
AGTSPTVWSGSVGILREYHKSNGVPVKYGQCWVFAGVCTTVLRCLGIPARTVTNYSSAHD
TDVSLTTDVYLDENLEPIPHLNTDSLWNFHVWNDCWMARPDLPPGNGGWQAVDSTPQETS
QGTFRCGPSSLAAVRNGFVYLKHDTPFVFAEINSDKIYWQKNADGTFNQIYSETKTVGHN
ISTKAVGSDERHDITHLYKHAEGSEEERIAVETACKYGSKAATFSTSKAEDVSVEVSMDG
EGPKMGQGADLSITLVNSSSEHRSVALHSQISVMYYTGVHKAIIGRDRTDVDIQPNEVTA
LEWTLKYEDYKEQLVDQAALMLTLSGRVKETRQVLATQFSFRLRTPDLTIKPLGEAVVGD
RMAVEISFTNPLPRVLKAVIIHVEGLGLVTARKITYGDIDSLADVSVTEQIVPSLPGTRK
LTASLDCEQLTQVHGVADITVEER
Download sequence
Identical sequences H3DJU1
99883.ENSTNIP00000020787 ENSTNIP00000020787 ENSTNIP00000020787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]