SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020974 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020974
Domain Number 1 Region: 426-483
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000811
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 307-364
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000981
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 485-538
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000127
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 4 Region: 240-290
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 5 Region: 183-241
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000249
Family TSP-1 type 1 repeat 0.0095
Further Details:      
 
Domain Number 6 Region: 368-421
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000017
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020974   Gene: ENSTNIG00000017818   Transcript: ENSTNIT00000021207
Sequence length 587
Comment pep:known_by_projection chromosome:TETRAODON8:18:521970:526327:1 gene:ENSTNIG00000017818 transcript:ENSTNIT00000021207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVVRGNFTRPFLRIGYHKITEIPGGARNISIQEAKKSRNYLALLTKAGMSIINGNWLIDR
PGMLTAVGTQLTYLRPNEIRARSGESITAPGPLSEDLHLYLIYQQPGASVYYEYTVPVQN
THSGPEPASPSSVPSLKSAECFPELLEAGGDVHVRGKGQAQELGKLFSVSILCKIKTATA
NHPSYTWTRSRHAECSSTCGTGRRHILWECVEKDSQATVSADLCDPSLEPTNTEDCNIQP
CPAYWDLGEWSECSRRCGPGTQHRQVICRQVTHVNTNGTELSLTVAPELCGVSGRPATAS
RCQLKICSQWEVRSEWSLCSVPCGVGQQRREVVCVSNQGDVENDQECNVNLRPESLQNCD
MGACARSWFTSLWSQRCSAECGQGNRTRAAICLTNHVTDLPLDSCEGDRPAEVTPCDSGP
CRNRLEWYTGPWGQCSAECGNGTQTRSVACISNNRGRMEVVDGLRCSSRPRPAAVQLCTS
KPCGVQWYVTEWSACSRSCNGGYRVREVRCLSDGAAPSDRCDPGLTPEGKEECNKQPCLV
ETDSGCRDQYYNCLVVVQAQLCIYPYYTNICCASCSRAQKTHPRSAQ
Download sequence
Identical sequences H3DKC8
ENSTNIP00000020974 99883.ENSTNIP00000020974 ENSTNIP00000020974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]