SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021122 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021122
Domain Number 1 Region: 221-368
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-32
Family Third domain of FERM 0.0014
Further Details:      
 
Domain Number 2 Region: 111-220
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-22
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 3 Region: 18-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.44e-21
Family First domain of FERM 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021122   Gene: ENSTNIG00000017960   Transcript: ENSTNIT00000021355
Sequence length 1052
Comment pep:known_by_projection chromosome:TETRAODON8:13:4350338:4371266:1 gene:ENSTNIG00000017960 transcript:ENSTNIT00000021355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWKMLVIIFSLLNLQMTEGRRCQVHLLDDRKLELLVQPKLMAKDLLDLVASHFNLKEKEY
FGIAYTDETGHFSWLQLDRRVLELDRRVLEHEFPKKSGPIVLYFCVKFYIESISYLKDNA
TIELFFLNAKSIIYKELIEVDSDVVFELASYILQEAKGDFTSNDATRSDLKKLPALPTQA
LKEHPSLAYCEDRVIEHYKKLSGQSRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWL
GLSYKGIFQYDHQDKVKPRKVFQWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIA
VHTWYACPALIKSIWAMAISQHQFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLA
NMGSKGKIISGTCGSLLSSGSQESDSSQTAKKDMLAALRARQEALEETLKQRIEELKSIC
IREAELTGKLPKEYPLDPGEEPPTVRRKIGTAFKLDEQKILPKGEEEELERLEREFAIQS
QITEAARRLASDPHVNSKKLKKQRKTSYLNALKKLQEIENSINEYRVRSGKKPTQRASLI
IEEANIGSEDSSLSDALVLDDDDPQITGTPTFSPVASPHKGLPPRPPSHSRPPPPQSLDG
LRHMHYTRSDYDKSPIKPKMWSESSLDEPYEKVKKRSSHSSHRRFPSSGSAEAGGSNSLQ
SSPIRNPPHWNSQSSMPSTPDLKTRPHYVHSTRSVDISPTRLHSLAQHFRNRSSSLESQA
KLLVSDSDAHPHALGTLGSPDFFLGPGRSSNGSDPLDDCSSCTSQSSSEHYYPSGGPPGS
NPNYSTLGEDSPSKARQRQRQRHRSAGHLGSSNSGSMPNLAAKNGTGGCSGGGGMGGGQH
GIYLHSQSQPSSQYRIKEYPLYVEGSPNPVVVRSLESDQEGHYSVKAQFKTSSSYTAGGL
YKEAWGGDEGGEGSGRLTPSRSQIVRTPSLGREGSGGGRAAVSEELRCWYQRSSGSLKDR
NHSHSGSTSSETGSQQGTLGHGRGSRVGTLAKGSPAASPHSQRNMPPSGEQAVTPTPPCS
PQHILNWQSGGTADSSPTEDTCQSPPQPSSDA
Download sequence
Identical sequences H3DKS5
ENSTNIP00000021122 99883.ENSTNIP00000021122 ENSTNIP00000021122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]