SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021145 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021145
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-27
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 354-409
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000159
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021145   Gene: ENSTNIG00000017981   Transcript: ENSTNIT00000021378
Sequence length 425
Comment pep:known_by_projection chromosome:TETRAODON8:3:9846600:9848969:1 gene:ENSTNIG00000017981 transcript:ENSTNIT00000021378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMTRYHKAAIDGYLDLLKEATRKDLNTPDEDGMTPTLLAAFHGHIDALQLICSREGDPNK
SDIWGNTPLHHAAANGHMHILSFLVNFGANIFALDNEFHTAMDVAASQDRMDCVRFLDAA
ASQQHQNAKKVAMQKKEAVKEAEKRVKLCEKVTKKHQSRMDKLQRGGSKIGPDTEANGAA
TFSNGGTVTSTNEQFSKLIAAEKTGSLSSRVKDTLQRKLGKKGRGTVQSSGGDGNEGGAS
EKPEFLDVFHEQDEILENDVTEDFEEDLDEEELGQSKQSIFNRPGLGGLIFMKKMGMESE
DMPRANMENLGYLVQNELCVEEEDAVGFEETGDTDLPWHQEDLGLDDDEDDDSSPLDVFL
SAISLQEFAVAFSKEHLDMEALMLCTDEDLKGIRIQLGPRKKILEAVARRSHTLKTPGII
KDSSL
Download sequence
Identical sequences H3DKU7
ENSTNIP00000021145 99883.ENSTNIP00000021145 ENSTNIP00000021145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]