SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021311 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021311
Domain Number 1 Region: 152-262
Classification Level Classification E-value
Superfamily Cadherin-like 8.82e-26
Family Cadherin 0.00037
Further Details:      
 
Domain Number 2 Region: 263-377
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-24
Family Cadherin 0.00065
Further Details:      
 
Domain Number 3 Region: 373-490
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-22
Family Cadherin 0.0056
Further Details:      
 
Domain Number 4 Region: 483-591
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000916
Family Cadherin 0.018
Further Details:      
 
Domain Number 5 Region: 78-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000406
Family Cadherin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021311   Gene: ENSTNIG00000018145   Transcript: ENSTNIT00000021546
Sequence length 805
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:22802179:22829534:1 gene:ENSTNIG00000018145 transcript:ENSTNIT00000021546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRPRHPSGKMRTVLVVVSCVLCLGLPLDALALNRQRTLGAPEKEEKLLKRVRRGWMWNQF
FLQEEYTGSDYQYIGKLQSDQDHGNGLVKYVLSGEGAGNIFIIDENNGDLHATRRLDREE
KAYYILKATVVNKRTGQKLEPETEFTIKLHDINDNEPHFSQEVYTGSVPERSDIGTSVIQ
VTATDADDGMYGNSAKLVYSISQGHPYFSVDPNTGVIRTALGPGDMDREQREHYQVVIEA
KDMAGQRGGLTGTTVVNITLTDVNDNPPRFTQSIYQFRVPESSESGTPVGRIRAADKDIG
ENAEMYFTIVSGDGLDTFDIFTDKATQEGVITVSKPLDYEKKPSYTVEIQVQNTQIDPRF
MSPGSKDVATVRIAVEDVDEPPLFDKASYLMEVKEDAAVGVALGSVSAIDPDGARNIVKY
AIDRRTDMDHLFNVHPGNGSVFLLKSLDREESAWHNISVIATELHNSRQSSHVPVFIHLL
DVNDNAPTLATVYETFVSRPNQNRYLRIQTVRAVDVDEPSAGHKFYFSLAPEGTYRSNFT
IRDNGDNTASILTRRASYSRLQQSMYLVPVVITDGDYPMQSSTGTLTVRVCTCDRDGNME
LCNPQPLSSSPGLSTGALIAILLCAIILLMIVVLFTALKRQRKQEPLIISKEDVRDNVVS
YNDEGGGEEDTQAFDIGALRHPQSAAVLEESTKQRRDIMPTDTLLYPPHRQHGSCSSGLL
MPPLAVPSRDFINQRVLENDCYPTAPPYDSLATYAYEGAGSVAESLSSLGSLSSEADQDY
QYLSDWGPRFRKLADLYGAEDADFS
Download sequence
Identical sequences H3DLB3
99883.ENSTNIP00000021311 ENSTNIP00000021311 ENSTNIP00000021311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]