SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021411 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021411
Domain Number 1 Region: 130-378
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 1.06e-81
Family Oxidoreductase molybdopterin-binding domain 0.0000000127
Further Details:      
 
Domain Number 2 Region: 380-507
Classification Level Classification E-value
Superfamily E set domains 1.75e-37
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.00000482
Further Details:      
 
Domain Number 3 Region: 39-120
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.1e-20
Family Cytochrome b5 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021411   Gene: ENSTNIG00000018245   Transcript: ENSTNIT00000021646
Sequence length 510
Comment pep:known_by_projection chromosome:TETRAODON8:11:7948686:7951005:1 gene:ENSTNIG00000018245 transcript:ENSTNIT00000021646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWTHVLAGLVAGTGAVLAYSLHHHKAQQTETAIEKRSALPVFTQEEVTSHRSLEDGVWVT
YRGGVYDITEFVAVHPGGDKILLAAGGALEPFWSLYAVHNQEHVLEILSEYKVGELSAED
LKKQRSVQTADPYSSDPVRHPGLRVNSLKPFNAEPPSEILSDSYITPSAIFFKRNHLPVP
RVDPGSYRLQVEGLPGGALALTLEDLKTKFPKHTVTATLQCAGNRRSEMNEVKQVKGLNW
GIAAISNATWGGAKLRDVLLAAGYRPEVATWARHVQFEGLDRDASGTYGASIPINKAVSE
DGDVLLAYEMNGEDLPADHGYPLRVVVPGTVGARNVKWVGRITVSAEESGSHWQQNDYKG
FSPGTDWDTVDYKSAPAIQELPVQSAITSPADGAAVEGSSQEVTVRGYAWSGGGREVVRV
DVSLDGGKTWQVARLEGGQDQAPPPPGRAWAWKLWELQAPLPPGAQELEIVCKAVDSSYN
VQPDSVLPIWNLRGVLSNAWHRVRVKVRED
Download sequence
Identical sequences H3DLL3
ENSTNIP00000021411 99883.ENSTNIP00000021411 ENSTNIP00000021411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]