SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021633 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021633
Domain Number 1 Region: 48-294
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.11e-42
Family Ankyrin repeat 0.0000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021633   Gene: ENSTNIG00000018459   Transcript: ENSTNIT00000021868
Sequence length 313
Comment pep:known_by_projection chromosome:TETRAODON8:8:6390911:6392693:-1 gene:ENSTNIG00000018459 transcript:ENSTNIT00000021868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMSSFWPLLGPSHSPQVSFGSPMDMAKLEEARMLLRGMDYNRATGQDEDGDTILHIYVAK
GLREYAFAAAEKLRSLDKLDAKEHKGKTALLVAVAANQPEIVQDLLSLEADINACDVNGQ
TALHLAAHYGFPVVLQAILSNRPAVNLEARNFEGMTPLHCAAISHSATMKALSSGGLPDV
ALQGKAAEKLSCVQKLLSSGASLLSQEIKSNKTVLHLAVKEGNVELVRYLLRTSLPNMKD
FVNLKAHGHTALHMAAGLHGNPHQEEILRLLLSKGADPSIRNLENDQAAHLLQSGHQGEQ
LKLMLKRRSGSSR
Download sequence
Identical sequences H3DM85
ENSTNIP00000021633 99883.ENSTNIP00000021633 ENSTNIP00000021633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]