SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022406 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022406
Domain Number 1 Region: 2-193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000001
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 2 Region: 1467-1532
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000513
Family VWC domain 0.0064
Further Details:      
 
Domain Number 3 Region: 644-711
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000209
Family VWC domain 0.01
Further Details:      
 
Domain Number 4 Region: 1526-1593
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000502
Family VWC domain 0.012
Further Details:      
 
Domain Number 5 Region: 1843-1909
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000188
Family VWC domain 0.02
Further Details:      
 
Domain Number 6 Region: 1585-1652
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000199
Family VWC domain 0.012
Further Details:      
 
Domain Number 7 Region: 883-951
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000481
Family VWC domain 0.0047
Further Details:      
 
Domain Number 8 Region: 827-890
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000126
Family VWC domain 0.0063
Further Details:      
 
Domain Number 9 Region: 1001-1066
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family VWC domain 0.0099
Further Details:      
 
Domain Number 10 Region: 585-653
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000356
Family VWC domain 0.051
Further Details:      
 
Domain Number 11 Region: 702-770
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000596
Family VWC domain 0.0071
Further Details:      
 
Domain Number 12 Region: 763-832
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000272
Family VWC domain 0.0072
Further Details:      
 
Domain Number 13 Region: 1121-1184
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000356
Family VWC domain 0.0089
Further Details:      
 
Domain Number 14 Region: 1350-1418
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000889
Family VWC domain 0.0098
Further Details:      
 
Domain Number 15 Region: 1773-1845
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000262
Family VWC domain 0.028
Further Details:      
 
Domain Number 16 Region: 1178-1242
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000418
Family VWC domain 0.01
Further Details:      
 
Domain Number 17 Region: 1295-1345
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000847
Family VWC domain 0.088
Further Details:      
 
Domain Number 18 Region: 1235-1296
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000209
Family Fibronectin type I module 0.049
Further Details:      
 
Domain Number 19 Region: 2176-2241
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000638
Family BSTI 0.036
Further Details:      
 
Domain Number 20 Region: 1418-1473
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000701
Family VWC domain 0.018
Further Details:      
 
Domain Number 21 Region: 942-1003
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000314
Family Fibronectin type I module 0.059
Further Details:      
 
Domain Number 22 Region: 1649-1702
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000847
Family VWC domain 0.022
Further Details:      
 
Domain Number 23 Region: 1071-1126
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000879
Family VWC domain 0.02
Further Details:      
 
Domain Number 24 Region: 1735-1783
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000167
Family VWC domain 0.017
Further Details:      
 
Domain Number 25 Region: 539-592
Classification Level Classification E-value
Superfamily FnI-like domain 0.000022
Family VWC domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000022406
Domain Number - Region: 302-335
Classification Level Classification E-value
Superfamily FnI-like domain 0.00628
Family VWC domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022406   Gene: ENSTNIG00000019209   Transcript: ENSTNIT00000022645
Sequence length 2248
Comment pep:known_by_projection chromosome:TETRAODON8:13:3768405:3781910:-1 gene:ENSTNIG00000019209 transcript:ENSTNIT00000022645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLDLLAPLNMSDHISGVLRLQSPSGPATYRIRPRAPNLTLPPGYSRLLHSRIRGSLGVHL
VALQAPGTSATLLSLSSASSPILQIISSTLNNTLDLSFLNGEGGGRRSASFGFPGRNPFS
REEWVQLAVSLEPERLAFYVDCQEAVTLHLKQEEKIYLLIPQGVVVTLASTPGRKDSKFS
GYLKRAEISLQPYQQRPWLCDNVTGMLQRPVPSSQPQSSRRAKEKTGRFPQDVQSDQLQR
AAALGPPASPQGGKSPEAKGDQLKRLEQRLEQLAAMLEMLKTQNADLQSRVQYLEGCECV
KQRCVWEGRSVEDGQSWQTDHGVCTCTSGKVKCQANVKVWVQASTENTLFSLYSGISGIR
QSKKRNCFPTCVGHRDKCSLGGCCRQKIPILNISEGSGEATWLRASSVHQTFINLHYENY
KPHAFPSLLRHWEEAPPEFTSTILVDKFGAKQQKRPAGGWLCRETSRRVLPVHFCSSFPS
SKSAPALIDLLMGVFNSWKAAGTSAFYYWPVKHSLREQVQVYYITVCCRSVITGSISVLC
SGCEVDGTYSDLDGCQTCTCKGGVKECRPLPCPSLDCTLKESVPGECCQRCKGCVHAGVH
YEHGSRWRLAENPCDVCSCLEGSARCEREPCSTPCSNPAAPLPNSCCPVCQGCGVNGQDY
PNGARIPAGDPCQDCTCVNGNVLCSAHPCPSLPCRNPVRRPGDCCPRCEQCEYESQLYVD
GQKFSSRAEPCLHCRCSAGEVSCERVDSLCPAPRCSHPATRKGECCPTCNDCEYEQKVFA
DGKVFVPAGSGPCLQCRCKLKSGSVICRQEKCPPVKCTNPIIDPHVCCPICRACVLDEVE
YAEGSSWHPDGPCSICTCTNGAPQCSPTRCLPTDCLHPTRGPGSCCASCESCTYNHRIYA
NGQRFATPEQPCHVCSCQYGSVRCERSPCPPLNCSNSYTPPGECCPKCPDCYFENRVFVD
GEAFPNPLNVCEECKCVSGLTECQQTQCPRPHCNAPLSGQCCQNNCNGCNYAGKEYPNGQ
EFPHPTDSCRTCSCINGNVQCLKKRCPQLSCLNPNLQPGDCCPKCPAPPSDCVFERRAYR
HSQHFHHPSDGCQSCACTDGAVHCQRKPCPFAACSHPILQDCCRTCEGCLHEGRERANGE
MWNDSSDPCAACVCREGSVRCDRKPCPPPNCKHPVQRQCCMSCDGCLYHGREYADGTEFA
DGNDPCGVCYCYGGEVVCTRIPCYGDCSHPYKPAGQCCGECERCFYNGAVLMNGQSIPDP
GNLCSECTCQSGSVRCLRASCPPPLCSHPVTNACGCPVCEGCHYRGLTYGDGQIFPGEDG
CQNCTCSRGEVVCAQQRCPAVLCSHPALDGCACGVCDGCLFYGRSCFNGEQFPNPADRCQ
LCSCSSGSVVCSRLSCPSVACVNPVTLPEDCCPRCTGVCRHLGTEYQSGTTFASPSDPCS
SCSCLNEVVTCQRRPCPVQCSHPVPSGTCCPVCDSCLYEGVVHTHGHTFTLSSNPCKRCT
CTRGTVTCVPVVCPQTPCLRPVTKPGQCCPVCGVCRLDGREFSEGQTWTLSSNHCSTCTC
QAGEVKCASPDCPKLPCMHQVTDPGTCCPRCRGCMYGGQERAEGSSWFAGSTPCISCTCA
DGVSTCSEIRCLSPCTNFVRVPGECCPVCADCVFEGRVYGPGDSFHPAGDPCQICTCEVL
PDGEQHLRCYRKRCPSLVDCPKSNILFSGTRLLLSHLCTEPLSNCTAARIGHEISATDDP
CVTCHCKDLTWTCLHQTCPQLTCPPNEQSTPTGSCCPVCKDCVIEGQNRRVANGSRWTDS
DDDCITCTCRLGYIECNIEECSPVKCPNGQKQVKIPGKCCTECQDSSASCLYQGTVYHSD
EQWEVDVCTSCTCMSGDVHCQSQRCPPLTCAADEMPAIVPGLCCPHCLPRPATCTAFGDP
HYRTFDGRMLHFQGTCTYILANDCQGGDFSIHVTNDDRGRKGVSWTKEVTVLIGAITVQL
LQDWVVKVNDELVSLPLLREPHIYVERQSNIILLNTNIGLKVMWSGRSHLEVSVPGTYKG
KTCGLCGNFNNYHQDDLRMPNGQISQSEADFGNSWKVTNGSRSLSSCRAGEDIDPCKHAG
YQAKKGANARCKVLKSAAFKPCHHVVPPEPWYGACVYDLCACGANTDECLCDTLEAYASR
CREAGVILQWRSTSLCAVGCPVERGLVFDECGPPCPVTCFNRDVPLGVVESHCFKPCVPG
CQCPAGLVLHNSYCIQPEKCPKIIHGDA
Download sequence
Identical sequences H3DPF7
99883.ENSTNIP00000022406 ENSTNIP00000022406 ENSTNIP00000001433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]