SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022702 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022702
Domain Number 1 Region: 39-137
Classification Level Classification E-value
Superfamily vWA-like 1.33e-21
Family Integrin A (or I) domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022702   Gene: ENSTNIG00000019485   Transcript: ENSTNIT00000022941
Sequence length 137
Comment pep:novel chromosome:TETRAODON8:Un_random:101943314:101944037:-1 gene:ENSTNIG00000019485 transcript:ENSTNIT00000022941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACAPLWSQECGTSAFSTGICTSVSDNLEPGEAIAPTSQRCSTYMDIVIVLDGSNSIYPWY
EVQNFLSNILSKFHISTDQMQFVWSNVQVGILQYGEVALHEWSLKDYQTTQEVVEAAKNI
SRQEGRETRTAYAIHKA
Download sequence
Identical sequences H3DQA3
ENSTNIP00000022702 ENSTNIP00000022702 99883.ENSTNIP00000022702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]