SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022742 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022742
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.7e-62
Family Fibrinogen C-terminal domain-like 0.00000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022742   Gene: ENSTNIG00000019518   Transcript: ENSTNIT00000022982
Sequence length 158
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:43540294:43541093:1 gene:ENSTNIG00000019518 transcript:ENSTNIT00000022982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQGFGNIDGEYWLGLENIYWLTNQGNYKLLITLEDWSGRKVFAEYASFRLEPEADFYKLR
VGRYHGNAGDSLTWHNGKQFTTLDRDHDAYTGRNCAHYQKGGWWYNSCAHSNLNGVWYRG
GHYRSRYQDGVYWAEFRGGAYSLKKVVMMIRPNPNTFH
Download sequence
Identical sequences H3DQE3
ENSTNIP00000022742 99883.ENSTNIP00000022742 ENSTNIP00000022742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]