SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000023035 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000023035
Domain Number 1 Region: 15-81
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000305
Family Ovomucoid domain III-like 0.0077
Further Details:      
 
Domain Number 2 Region: 184-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000466
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000023035   Gene: ENSTNIG00000019773   Transcript: ENSTNIT00000023277
Sequence length 292
Comment pep:known_by_projection chromosome:TETRAODON8:15:559832:562693:1 gene:ENSTNIG00000019773 transcript:ENSTNIT00000023277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAADQAEKKSDLRLCDDSTCRFGGVCRDDGSQLRCVCQFQCHKHYVPVCGSNGDTYQNEC
YRLQAACRQQRLISRVAEGPCATGGSAAEPPSQLEPNGALVCPQIRDQAPETLTMSKAPP
PTPAGGSPSSARFNSFPIFTNTLIYNPILFLYSTFNNHYHIYFKHHFIISFYSHTSFYXP
HAGMPLPCSDGLAGSCLHGQCEIRHSAATCRCDAGYKGAQCDEPQEFNVLYVVPSGQKLH
YILIAAIIGAVQIAIIVAVVMCITRKCPKNNRGRRHKQTLGHFSPDTNSRMV
Download sequence
Identical sequences H3DR86
99883.ENSTNIP00000023035 ENSTNIP00000023035 ENSTNIP00000023035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]