SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000001178 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000001178
Domain Number 1 Region: 6-427
Classification Level Classification E-value
Superfamily Sema domain 9.94e-96
Family Sema domain 0.00000501
Further Details:      
 
Domain Number 2 Region: 424-461
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000144
Family Plexin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000001178   Gene: ENSTRUG00000000497   Transcript: ENSTRUT00000001182
Sequence length 511
Comment pep:known_by_projection scaffold:FUGU4:scaffold_175:200488:212164:-1 gene:ENSTRUG00000000497 transcript:ENSTRUT00000001182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHKPENYISMYHQEGSDTMYVGGQAVIYVLTFTNRGIRDLQVHSLISLCRADLECDNFIT
VIQKVNDTMIVCGTNAGSPRCWMLVNDTVLTDVQGVQIASASDISPAYPSQRSISLPADG
SLYSAMSSATGHAGSIRRTFGSQKLLKTENVWLLNPQFAGAAVIPSDQKLKEEMYFLFSE
FNKTARVDEEPYRARIGRVCTVDEGGIKALLADSWTTFMKARVMCGAGNTQQQYNNLKQA
VVLTEQDQRAGVLYGLFSNAWGRKVICAYSIKDIDQAFSTSKLKGYSSPFIGSRPGTCVR
KNSTPGGPSDIKNLGVIRYHPEIEDVIRPNGVAPLDLPTDDQITHMVADIVLAVNDEHYS
VLYLGTEQGKVLKVLHFREGVFIISQYSLFHNEGPVLNMAVDSQKGHLYIGTAMEVQQLP
LADCGRYGDTCRECILSRDPYCGWDWARRRCIAIPPGYNVTTGSLTFCGPHQRGCPSLKL
RRTSPKEVKVQSNTTIFLPCPVRSFHATYRW
Download sequence
Identical sequences H2RM15
ENSTRUP00000001178 31033.ENSTRUP00000001178 ENSTRUP00000001178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]