SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002045 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002045
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily C-type lectin-like 7.66e-35
Family C-type lectin domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002045   Gene: ENSTRUG00000000855   Transcript: ENSTRUT00000002054
Sequence length 134
Comment pep:known_by_projection scaffold:FUGU4:scaffold_424:50576:51449:1 gene:ENSTRUG00000000855 transcript:ENSTRUT00000002054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CALNWDPFGKSCYFFSNVAMTWDEAQDWCTGHESHLVILSTDKEWDFVVKHSAGTWYWVG
LTDRTGKWEWVNHTPYVMDRRRWRPGQPDSWTGHGLGHGDEDCGQLHSDGRLNDLHCLTQ
LRYICQKHRRNARL
Download sequence
Identical sequences H2RPI2
ENSTRUP00000002045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]