SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002734 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002734
Domain Number 1 Region: 74-167
Classification Level Classification E-value
Superfamily Virus ectodomain 3.45e-20
Family Virus ectodomain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002734   Gene: ENSTRUG00000001169   Transcript: ENSTRUT00000002750
Sequence length 210
Comment pep:novel scaffold:FUGU4:scaffold_3269:7511:8151:1 gene:ENSTRUG00000001169 transcript:ENSTRUT00000002750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WWLCGHNAYAHLPANWSGVCTPVHFNDHTVIIYVTNARTAPQLHSRRDLNIDFKPHDSVW
GTDVPQECTGQREKSLFPWAGVAKNILRLETVDYRLKAFTNLTKVALTGVKEELTALRLM
TMQNRMALDLLTASRGGVCTMVGDYCCTFVPENDADGHVIDKLQKAMIDDGSPPLDWFTS
MILRWRELLFKIGAVIGIVLIVLAILACCV
Download sequence
Identical sequences H2RRG8
31033.ENSTRUP00000002734 ENSTRUP00000002734 ENSTRUP00000002734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]