SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002827 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002827
Domain Number 1 Region: 65-483
Classification Level Classification E-value
Superfamily Sema domain 3.01e-128
Family Sema domain 0.00000048
Further Details:      
 
Domain Number 2 Region: 479-512
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000296
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002827   Gene: ENSTRUG00000001211   Transcript: ENSTRUT00000002843
Sequence length 781
Comment pep:known_by_projection scaffold:FUGU4:scaffold_175:428065:451168:1 gene:ENSTRUG00000001211 transcript:ENSTRUT00000002843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPRTGLPAFLAFTFAAFLPQLSSGGTPFPQDLEPLSHVGRENSGVSSQELFQGLMSDNDT
VRLGLDFQRMLRINHMLYIAARDHVFAVNLAVSSEQITPQQKLTWKTKDVAKCTVRGKNS
DECYNYIKVLVPRNDETLFACGTNAFNPTCRNYKMATLEQEGEEVVGQARCPFESRQSNV
GLFAEPHFLHAIEYGNYVYFFFSEIAVEYTALGKVVFSRVARVCKNDNGGSPRVLERYWT
SFLKARLNCSVPGDSFFYFDVLQSLTNVLQINRRPAVLGVFTTQANSITGSAVCAFYMDD
IEKAFSGKFKEQRNSESVWTPVPDEQVPKPRPGCCAGEGSAAAYKSSTTFPDETLTFIKT
FPLMDESVPSVNDRPYFTRTTSRFKLTQIAVDTSAGPYKNHTVVFLGSDNGHVLKVLAST
EGANASFSTLLLEDIDVYNPNKCDVRGEDRRVLGLELDRDHHAVFVAFSSCVIRVPLSRC
SDYSTCRKSCLSSRDPYCAWLKSGGCVAVSPGFKDGAPTFPMQSDGGGDRCEKCQTDADG
SPSGPSVCCPSSFLLPPPPPPPPLPPSLQPQGRPHPQAPPQPLKGQHFQSVRRPPELDKS
NHSVHYTLLIACVLVAFVLGAFLSGFLVSCYCNHTGHKTKKLSKDPEAPIPHALSLRSLA
KLNGLLDSQSKDEKMEVSSPQIYNSFFSSSKEHHPSRLSGLPTPDSTPELPIKSMKAFRN
QWEKNQNCNNAKEPKSHNMGSRADERKIPNVERVPPPQPFPEACQKVMEVTSLDELLRHI
H
Download sequence
Identical sequences H2RRR1
ENSTRUP00000002827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]