SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002830 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002830
Domain Number 1 Region: 57-516
Classification Level Classification E-value
Superfamily Sema domain 1.11e-145
Family Sema domain 0.000000164
Further Details:      
 
Domain Number 2 Region: 512-547
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000732
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002830   Gene: ENSTRUG00000001211   Transcript: ENSTRUT00000002846
Sequence length 1075
Comment pep:known_by_projection scaffold:FUGU4:scaffold_175:428083:451732:1 gene:ENSTRUG00000001211 transcript:ENSTRUT00000002846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAFLAFTFAAFLPQLSSGGTPFPQDLEPLSHVGRETSYLYPSFQGLMSDNDTVRLGLDFQ
RMLRINHMLYIAARDHVFAVNLAVSSEQITPQQKLTWKTKDVAKCTVRGKNSDECYNYIK
VLVPRNDETLFACGTNAFNPTCRNYKMATLEQEGEEVVGQARCPFESRQSNVGLFAGGDF
YSATMTDFLASDAVIYRSLGESNPVLRTVKYDSKWLREPHFLHAIEYGNYVYFFFSEIAV
EYTALGKVVFSRVARVCKNDNGGSPRVLERYWTSFLKARLNCSVPGDSFFYFDVLQSLTN
VLQINRRPAVLGVFTTQANSITGSAVCAFYMDDIEKAFSGKFKEQRNSESVWTPVPDEQV
PKPRPGCCAGEGSAAAYKSSTTFPDETLTFIKTFPLMDESVPSVNDRPYFTRTTSRFKLT
QIAVDTSAGPYKNHTVVFLGSDNGHVLKVLASTEGANASFSTLLLEDIDVYNPNKCDVRG
EDRRVLGLELDRDHHAVFVAFSSCVIRVPLSRCSDYSTCRKSCLSSRDPYCAWLKSGGCV
AVSPGFNKGGSEQDVENGYHQLVPDTCHGETARSARPRDFADSAKSCSDAEEIRNESQSQ
TPHRPPLTSLTTNTITTHQCFTLAEQSPDKTKFSEDTWQIDQRVRRPPELDKSNHSVHYT
LLIACVLVAFVLGAFLSGFLVSCYCNHTGHKTKKLSKDPEAPIPHALSLRSLAKLNGLLD
SQSKDEKMEVSSPQIYNSFFSSSKEHHPSRRPHHHHHHTMGDLVNAHHHLHHSSELSGLP
TPDSTPELPIKSMKAFRNQWEKNQNCNNAKEPKSHNMGSRPGSALLHQQVFPYSHGLSNG
PPLVGGHLQADERKIPNVERVPPPQPFPEACQKVMEVTSLDELLRHIHEGSGKSSQLMSP
TGLLASGGQLPFSNRIQPQIPETESAPYYSSSTLPRDSLTRRMDVPPDIPAHHQSTLERR
HSSQRHSLMTAAGKIPGGVGMIPRQHSFSQRNGVPHQPPPLLARMNSTGSACEVHYPLIP
NGYLTRQQGYSAEQQELPHRGAIVRRTSSLKPDVPPKPLFIPATSPVNQQGKFNY
Download sequence
Identical sequences H2RRR4
ENSTRUP00000002830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]