SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002954 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002954
Domain Number 1 Region: 2-150
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.23e-17
Family G proteins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002954   Gene: ENSTRUG00000001275   Transcript: ENSTRUT00000002972
Sequence length 219
Comment pep:known_by_projection scaffold:FUGU4:scaffold_5445:2812:4372:1 gene:ENSTRUG00000001275 transcript:ENSTRUT00000002972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVQDYKEGTPEEKAYYIELWDVGGSIGSA
SSVKSTRAVFYNSVNGIILVHDLTNKKSSQNLYRWSLEALNKDSSPTGVIVSNGEYDREQ
FAENPVPLLLIGTKFDQIPETKRSEVLTRTAFLSEDFNAEEINLDCTNPRYLAAGTSNAV
KLSRFFDKVIEKRYFTRDPSQMTGFTDRKRFNFKSLHYD
Download sequence
Identical sequences H2RS38
ENSTRUP00000002954 31033.ENSTRUP00000002954 ENSTRUP00000002954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]