SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002995 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002995
Domain Number 1 Region: 18-114
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 4.97e-41
Family SWIB/MDM2 domain 0.0000738
Further Details:      
 
Domain Number 2 Region: 301-345
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 1.14e-17
Family Ran binding protein zinc finger-like 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000002995
Domain Number - Region: 445-487
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0942
Family TFIIH p44 subunit cysteine-rich domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002995   Gene: ENSTRUG00000001298   Transcript: ENSTRUT00000003013
Sequence length 500
Comment pep:known_by_projection scaffold:FUGU4:scaffold_169:33296:36869:-1 gene:ENSTRUG00000001298 transcript:ENSTRUT00000003013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTMSSLSAEPPSSSSSCRTLPGDGSQVQPKAPLLQILRVAGAQEEVFTLKEVMHYLGQYI
MGKQLYDKQRQHIVHCQDDPLGELLEVESFSVKNPSPVYEMLKKYLVVLGCAGNADAAEN
LSVGRECVESGVEDRVLLSSSSHAYVVRLSPSHWSLPNLPSTPSQRRPREPDEDSLEGLP
RSACKRPKLDVSLDEWDLSGLPWWFLGNLRSNYSCKSNGSTDIHTNQEEDTAIVSDTTDD
LWFLTEGESEQVSVEMKEAALEEGRGGEGEACSEEDDRAGKEEKGDREMQEEPDEDSQCL
SDDTDIEISTQDAWQCTECRKYNTPLQRYCVRCWALRKNWYKDVPRLAHSLSVPDIPACS
SLTAQDDEDDSDAGIDVPDCTRTVSDPVILPSHSTADRPLPPALSGKGKAPWSSSFHKDE
PLSEGDSQESLGMEVEEVRPEALLEPCKLCRVRPRNGNIIHGRTAHLLTCFPCARRLHKF
HAPCPGCGKIIQNVIKIFIL
Download sequence
Identical sequences H2RS79
31033.ENSTRUP00000002995 ENSTRUP00000002995 ENSTRUP00000002995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]